Previous Article | Next Article 
Antimicrobial Agents and Chemotherapy, July 2006, p. 2316-2322, Vol. 50, No. 7
0066-4804/06/$08.00+0 doi:10.1128/AAC.01488-05
Copyright © 2006, American Society for Microbiology. All Rights Reserved.
Proteolytic Degradation of Human Antimicrobial Peptide LL-37 by Bacillus anthracis May Contribute to Virulence
Joanne E. Thwaite,*
Stephen Hibbs,
Richard W. Titball, and
Timothy P. Atkins
Biomedical Sciences, Dstl Porton Down, Salisbury, Wiltshire SP4 0JQ, United Kingdom
Received 18 November 2005/
Returned for modification 3 February 2006/
Accepted 29 March 2006

ABSTRACT
In this paper we report on the susceptibilities of a range of
Bacillus species to the human antimicrobial peptide LL-37.
B. subtilis showed a low level of resistance to killing by LL-37
(50% growth-inhibitory concentration [GI
50], 1 µg/ml).
B. cereus and
B. thuringiensis showed intermediate levels of
resistance to killing (GI
50s, 33 µg/ml and 37 µg/ml,
respectively).
B. anthracis showed the highest level of resistance
(GI
50s, 40 to 66 µg/ml). The degradation of LL-37 by
B. anthracis culture supernatant was blocked by the metalloprotease
inhibitors EDTA and 1,10-phenanthroline, and the gene encoding
the protease responsible for LL-37 degradation was not plasmid
borne. Our findings suggest that alongside the classical plasmid-based
virulence determinants, extracellular metalloproteases of
B. anthracis may play a role in survival in the host.

INTRODUCTION
Bacillus anthracis, the etiological agent of anthrax, has been
recognized as a human and animal pathogen for centuries. Although
it is primarily a disease of animals, the potential for anthrax
to be used as a biological weapon (
21) has prompted renewed
interest in identifying effective medical countermeasures to
this disease.
B. anthracis is a rod-shaped, gram-positive, aerobic/facultatively
anaerobic, spore-forming bacterium. The spores can remain dormant
in the environment for extended periods of time and are highly
resistant to hostile environmental conditions. Anthrax predominantly
affects herbivores, such as cattle, goats, and sheep, although
all mammals, including humans, are susceptible. The bacterium
is mainly transmitted via spores rather than vegetative cells,
and infection is usually acquired through entry into the body
of spores from soil or infected animal products via inhalation,
ingestion, or cutaneous abrasions (
46).
Classically, the virulence of B. anthracis is determined by two major virulence factors, the anthrax toxin complex and a poly-D-glutamic acid capsule, which are encoded by plasmids pXO1 and pXO2, respectively (13, 25, 47). The loss of either plasmid markedly reduces virulence. Indeed, the Sterne animal vaccine strain is attenuated as a consequence of the loss of pXO2. However, there is mounting evidence for the presence of chromosomally located virulence factors, since double-cured strains B. anthracis (pXO1 pXO2) retain some virulence in mice (11). B. anthracis isolates are considered clonal, and apart from differences in plasmid content, only a few phenotypic variations between strains have been reported. Some isolates are resistant to penicillin, and a small group of isolates have an impaired ability to degrade a number of proteinaceous substrates (7, 10, 42, 43). Most significantly, and for reasons which are not clear, strains containing both virulence plasmids (pXO1+ pXO2+) may differ in virulence by up to 1,000-fold (42, 43).
Extracellular proteases have been implicated in the virulence of a large number of pathogenic bacterial species, as reviewed elsewhere (26). These proteases can perform a wide range of functions, including the acquisition of nutrients, deregulation of critical host processes (including interruption of cascade pathways, cytokine networks, and destruction of cell surface receptors), and inactivation of antimicrobial peptides (44).
Culture supernatant from B. anthracis Sterne has recently been shown to contain at least five distinct extracellular proteases (2). Subcutaneous inoculation of mice with concentrated filtered culture supernatant resulted in hemorrhage; however, the effect was abrogated when the culture supernatant was administered with immune sera raised in rabbits or chemical protease inhibitors (33). B. anthracis strains are considered clonal and possess an extremely high degree of homology at the whole-genome level. The inability to degrade extracellular proteins was previously identified in a small group of B. anthracis strains, including strain Vollum (10). Both the Ames and Vollum strains of B. anthracis are capable of causing disease in animals. However, the current U.S. vaccine is less effective at inducing a protective immune response in animals challenged with Ames, while complete protection was achieved against Vollum, thereby suggesting that this strain may be somewhat less virulent (22, 48). In this paper we hypothesize that the decreased virulence of B. anthracis Vollum may correspond to the reduced ability to degrade extracellular proteins.
Antimicrobial peptides are a ubiquitous component of the innate immune response and exhibit broad-range antimicrobial activities against gram-positive and gram-negative bacteria, fungi, parasites, and enveloped viruses (16, 17, 18, 19). Alongside their direct antimicrobial activities, these peptides play additional roles as mediators of inflammation and stimulators of the immune system (3, 6, 37). LL-37 is a unique human antimicrobial peptide that was initially isolated from human bone marrow (1, 24). LL-37 is constitutively expressed within neutrophils and is inducibly expressed on body surfaces, including the skin and respiratory epithelia, in response to infection, inflammation, or trauma (5, 12, 41).
It has previously been reported that a range of pathogens, including Enterococcus faecalis, Proteus mirabilis, Pseudomonas aeruginosa, Salmonella enterica, Staphylococcus aureus, and Streptococcus pyogenes (15, 30, 35, 40), utilize proteases to confer resistance to the antimicrobial activities of LL-37. In this study we aimed to determine whether variations in the extracellular proteolytic activities of B. anthracis strains provide resistance to LL-37.

MATERIALS AND METHODS
Bacterial strains, growth conditions, and media.
The
Bacillus species used in this study included
B. subtilis 168 and NCTC 3610;
B. atrophaeus subsp.
globigii (formerly
B. subtilis var.
globigii);
B. brevis NCTC 2611;
B. cereus 569,
ATCC 10876 NCTC 10334, NCTC 9946, NCTC 9939, and NCTC 11143;
B. thuringiensis subsp.
israelensis and
B. thuringiensis subsp.
israelensis; and a range of
B. anthracis strains, including
wild-type strain Ames (pXO1
+ pXO2
+), Sterne (pXO1
+ pXO2
),
Vollum 1B (pXO1
+ pXO2
+), and UM23-Cl2 (pXO1
pXO2
;
double-cured derivative of the Sterne strain). All strains were
obtained from the culture collection at the Defense Science
and Technology Laboratory (Porton Down, Salisbury, United Kingdom).
The Ames and Vollum strains of
B. anthracis were handled in
Advisory Committee on Dangerous Pathogens (ACDP) 3 containment
facilities both as vegetative strains and as spores.
B. anthracis UM23-Cl2,
B. thuringiensis, and
B. cereus strains were handled
at ACDP 2 containment facilities, and
B. subtilis was handled
at ACDP 1 containment facilities. All
Bacillus cultures were
maintained on Mueller-Hinton agar plates or broth (Oxoid).
Detection of extracellular protease activity.
Bacillus species were grown to late stationary phase in Mueller-Hinton broth at 37°C to allow maximal expression of extracellular proteases (23). Mueller-Hinton broth was chosen to allow comparison of the results with those obtained by the modified microtiter broth dilution method (48) for determination of LL-37 susceptibility. However, the protease secretion profiles in Mueller-Hinton broth were comparable for each of the strains when the strains were grown in a range of other culture media, including L broth and New Sporulation media (data not shown). The cultures (5 ml) were pelleted in a microcentrifuge, and the supernatant was passed through 0.45-µm-pore-size filters and then 0.2-µm-pore-size filters (Whatman International Ltd., Maidstone, United Kingdom) to remove all bacteria. The protease activity present in the culture supernatant was determined following the degradation of a universal protease substrate, resorufin-labeled casein, according to the manufacturer's instructions (Roche Diagnostics Ltd., Lewes, United Kingdom). The release of resorufin-labeled peptides by proteolytic activity was measured spectrophotometrically at 574 nm. Protease activity was quantified by using purified protease from Streptomyces caespitosus as a standard (Sigma-Aldrich Company Ltd., Poole, United Kingdom).
Peptide synthesis.
The peptides used in this study, including LL-37 ([LL-37, 37 aa]), were produced by Alta Bioscience, Birmingham, United Kingdom, by using standard 9-fluorenylmethoxy carbonyl protection chemistry. The purity and molecular weight were confirmed by high-pressure liquid chromatography and matrix-assisted laser desorption ionization mass spectrometry. The peptides were lyophilized and stored at 4°C. Stock solutions were prepared in phosphate-buffered saline (PBS) for the evaluation of antimicrobial activity and were stored frozen at 20°C in 1-ml aliquots to be ready for use.
In vitro assay for antimicrobial activity.
The antimicrobial activity of LL-37 was determined as the concentration of LL-37 required to inhibit bacterial growth by 50% relative to that of the (no-peptide) control (GI50). The GI50 values were measured by the modified microtiter broth dilution method (49). Briefly, liquid cultures were grown as described above to midexponential phase and then diluted to 1 x 104 CFU/well. Microtiter plates were prepared immediately prior to use, with peptide concentrations, arranged in triplicate, ranging from 0.5 to 200 µg/ml of LL-37 suspended in 0.02% acetic acid and 0.4% bovine serum albumin (Sigma-Aldrich Company Ltd.). A suspension containing 100 µl of diluted bacteria was added to each well of a 96-well microtiter plate, and then the plate was incubated at 37°C for 16 h. Bacterial growth was determined by measuring the absorbance at 620 nm with a Thermo multiskan EX microplate reader (Thermo Electron Corp., Basingstoke, United Kingdom.). Inhibition levels (GI50s) were defined as growth less than or equal to one-half of the growth observed in control wells in which no peptide was present. Assays were also carried out in the presence of protease inhibitors: 5 µM pepstatin (Sigma-Aldrich Company Ltd.), which inhibits aspartic proteases; 10 µM E-64 (Sigma-Aldrich Company Ltd.), which inhibits cysteine proteases; 4 mM Pefabloc (Roche Diagnostics Ltd.), which inhibits serine proteases); and 0.5 mM EDTA, 0.1 mM 1,10-phenanthroline, and 10 µM phosphoramidon (Sigma-Aldrich Company Ltd.), which inhibit metalloproteases.
Measurement of proteolytic degradation of LL-37.
Bacillus species were grown to late stationary phase in Mueller-Hinton broth at 37°C to allow maximal expression of extracellular proteases. The cultures (5 ml) were pelleted in a microcentrifuge, and the supernatant was passed through 0.45-µm-pore-size filters and then 0.2-µm-pore-size filters (Whatman International Ltd.) to remove all bacteria. Untreated filtered supernatant was analyzed as a control, alongside supernatant treated at 37°C for 1 h with 5 mM EDTA (to inhibit metalloprotease activity) and supernatant heated to 70°C for 1 h (to inhibit all enzymatic activity). To each 100 µl of treated supernatant, 5 µl of 1 mg/ml LL-37 was added. The supernatants were then incubated at 37°C, duplicate samples were taken at various time intervals, and the reactions were stopped by boiling (5 min). The samples were separated on 8 to 25% precast polyacrylamide Phast gel (Amersham Biosciences, Little Chalfont, United Kingdom) and then Western blotted onto nitrocellulose membranes. The membranes were blocked overnight for 16 h with 2% bovine serum albumin (Sigma-Aldrich Company Ltd.) in PBS and were then incubated for a further hour, following the addition of mouse anti-LL-37 antibody (1 µg/ml; Hycult Biotechnology, Uden, The Netherlands). The membranes were washed (three times for 5 min each time) in PBS containing 0.05% Tween 20 and were then incubated for 1 h with peroxidase-conjugated anti-mouse antibody (Sigma-Aldrich Company Ltd.), following the manufacturer's instructions, and then washed as described above. The labeled bands were visualized with 3,3'-diaminobenzidine (Sigma-Aldrich Company Ltd.). Once the membranes dried, they were analyzed to quantify protein degradation by using a Gene genius gel documentation system (Syngene, Cambridge, United Kingdom).
Preparation of B. anthracis spores.
B. anthracis UM23-Cl2 was cultured on the surface of Roux bottles containing New Sporulation medium (3.0 g Difco tryptone; 6.0 g Oxoid bacteriological peptone, 3. 0 g Oxoid yeast extract, 1.5 g Oxoid Lab Lemco, 1 ml 0.1% MnCl2 · 4H2O, and 25 g Difco Bacto agar made up to 1 liter with H2O) at 37°C until the cultures contained more than 95% phase-bright spores, as measured by phase-contrast microscopy; typically, incubation of between 7 and 10 days resulted in > 95% phase-bright spores. The spores were harvested by centrifugation at 10,000 x g for 10 min and then washed 10 times with ice-cold distilled water to remove any vegetative cells and cell debris. The spore preparation was heated at 70°C for 1 h to kill any remaining vegetative cells, and then the final spore concentration was determined by serial dilution. Spore preparations were stored at 20°C until they were required.
Germination assay.
B. anthracis spores (1 x 105 CFU/ml) were germinated in Mueller-Hinton broth at 37°C. Duplicate samples were taken at intervals throughout the germination process (0, 1.5, 3, 4.5, 6, and 7.5 h) and were then serially diluted in sterile distilled water. The first set of samples was plated out immediately and represented the total cell count (vegetative cells and spores). The second dilution series was incubated at 70°C for 1 h to kill any vegetative bacilli (spores only). From these values the percentage of vegetative bacteria in relation to the numbers of spores was determined over time.

RESULTS
Antimicrobial activity of LL-37 for Bacillus species.
LL-37 has attracted attention as a novel antimicrobial due to
its broad spectrum of activity, its presence at epithelial cell
surfaces, and its ability to stimulate the innate immune system
(
3,
4,
16). Initially, we determined the GI
50 values for LL-37
for a range of
Bacillus strains which show different potentials
to cause severe disease in humans. The bacteria were incubated
with 0 to 200 µg/ml of LL-37, and bacterial growth was
measured by spectrometry following a 16-h overnight incubation.
The antimicrobial activity of LL-37 differed markedly between
different
Bacillus species (Table
1). LL-37 showed high levels
of activity (GI
50s, 1 to 2 µg/ml) against
B. atrophaeus subsp.
globgii and
B. subtilis. In comparison, opportunistic
pathogens, such as
B. thuringiensis var.
israelensis,
B. cereus 569, and
B. cereus ATCC 10876, demonstrated lower levels of
susceptibility (GI
50s, 33, 37, and 35 µg/ml, respectively)
to growth inhibition by LL-37. The GI
50 of LL-37 for
B. anthracis Ames, an obligate pathogen, was 66 µg/ml, approximately
2-fold higher than that for
B. cereus and 33-fold higher than
that for
B. subtilis.
Effects of LL-37 against B. anthracis.
The activity of LL-37 against a range of
B. anthracis strains
that differed in their pXO1 and/or pXO2 plasmid contents was
determined by measuring the GI
50 of the peptide as described
above. The bacteria were incubated for 16 h overnight in the
presence of increasing concentrations of LL-37 (0 to 200 µg/ml),
the turbidity of the suspension was measured as described above,
and the GI
50 of LL-37 was calculated (Table
1). The GI
50s of
LL-37 for
B. anthracis strain Ames (pXO1
+ pXO2
+), strain Sterne
(pXO1
+ pXO2
), and strain UM23-Cl2 (pXO1
pXO2
)
did not differ significantly (66 µg/ml, 68 µg/ml,
and 63 µg/ml, respectively). This finding suggests that
the genes that confer resistance to LL-37 are chromosomally
located rather than plasmid borne. However, the level of resistance
of
B. anthracis strain Vollum to LL-37 was only two-thirds those
of
B. anthracis Sterne, Ames, or UM23-C12, with a GI
50 value
of 40 µg/ml.
Metalloprotease inhibitors increase the susceptibility of B. anthracis to killing by LL-37.
We hypothesized that the resistance of B. anthracis to LL-37 may be mediated by extracellular proteases. Thus, the GI50 of LL-37 for B. anthracis UM23-Cl2 was determined in the presence or absence of protease inhibitors. In the presence of metalloprotease inhibitors such as EDTA, resistance to killing by LL-37 was virtually eliminated (GI50, 1.25 µg/ml) (Fig. 1). In comparison, serine, cysteine, and aspartate protease inhibitors had no effect on the susceptibility of B. anthracis to LL-37 (data not shown).
Metalloprotease inhibitors decrease extracellular protease activity in B. anthracis.
The effects of chemical protease inhibitors on the extracellular
proteolytic activity of a range of
B. anthracis strains were
determined. The total proteolytic activity was determined by
measuring the degradation of resorufin-labeled casein. The percent
reduction in proteolytic activity due to the activities of protease
inhibitors was determined (Table
2). The total protease activity
of
B. anthracis Vollum was fourfold lower than that of
B. anthracis Ames. Addition of 0.5 mM EDTA reduced the extracellular protease
activities of
B. anthracis Ames, Sterne, and UM23-Cl2 by 80
to 90%. However, in comparison, the protease activity of the
B. anthracis Vollum strain was inhibited by 20%. In the presence
of a serine protease inhibitor, all strains of
B. anthracis showed decreases in proteolytic activity of between 4 and 12%.
Use of a combination of metalloprotease and serine protease
inhibitors resulted in an almost complete inhibition of proteolysis.
In three separate experiments, each with triplicate samples,
we found that the proteases produced by
B. anthracis Vollum
were more resistant to inactivation by EDTA. It is known that
B. anthracis produces a range of proteases, some of which are
inhibited by ion chelators (
2). Clearly, our results suggest
that not only different levels or proteases but also different
spectrums of proteases are produced by the
B. anthracis Vollum,
Ames, and Sterne strains. Synergies between different classes
of protease inhibitors are well documented (
38,
45), and this
is the likely explanation for the ability of a combination of
EDTA and Pefabloc to abolish 98% of the protease activity of
B. anthracis Vollum.
Culture supernatant from B. anthracis degrades LL-37.
The effect of the culture supernatant on the stability of LL-37
was determined in vitro. LL-37 was incubated in filtered culture
supernatant from
B. anthracis UM23-Cl2 or
B. subtilis 168, alongside
a culture supernatant that had been pretreated with 5 mM EDTA
(to inhibit metalloprotease activity) or heated to 70°C
for 1 h (to inhibit all enzymatic activity). Samples were taken
over 48 h and then analyzed by sodium dodecyl sulfate-polyacrylamide
gel electrophoresis and Western blotting with an anti-LL-37
antibody. The degradation of LL-37 was determined as a percentage
of the initial LL-37 concentration (Fig.
2).
In the presence of the culture supernatant from
B. subtilis,
LL-37 was stable, with over 90% of the full-length peptide detectable
after 48 h. Conversely, in the presence of the culture supernatant
from
B. anthracis UM23-Cl2, LL-37 was rapidly degraded, with
only 5% of the full-length LL-37 detectable after 6 h. Heat
pretreatment of the
B. anthracis supernatant resulted in increased
LL-37 stability, with the levels being comparable to those observed
with
B. subtilis. Metalloprotease inhibitors also protected
LL-37 from degradation, with 85% of the initial LL-37 detectable
after 48 h. This was slightly lower than that with heat treatment,
suggesting degradation by other protease classes. These data
suggest that
B. anthracis, unlike
B. subtilis, secretes a metalloprotease
which is capable of rapidly degrading extracellular LL-37.
B. anthracis culture supernatant increases resistance of B. subtilis to killing by LL-37.
We next investigated whether the B. anthracis culture supernatant could protect other Bacillus species from killing by LL-37. B. anthracis UM23-Cl2 or B. subtilis cells were grown to exponential phase, pelleted, washed, and resuspended in the filtered culture supernatant; and their susceptibilities to LL-37 were determined. Figure 3 shows that B. subtilis was more resistant to growth inhibition by LL-37 when it was resuspended in the culture supernatant from B. anthracis, with the GI50 increasing from 1 to 3.75 µg/ml. However, no significant difference in the resistance of B. anthracis to LL-37 was determined when it was resuspended in the B. subtilis supernatant (data not shown).
LL-37 is active against newly germinated spores.
The GI
50 assays reported above describe the effects of LL-37
against
B. anthracis cells harvested during exponential growth
in broth culture. Extracellular protease secretion in bacilli
is initiated during the transition from exponential phase into
stationary phase (
34), conditions which are unlikely to be achieved
in a mammalian host until late in the infection process. Anthrax
is usually a consequence of the entry of spores rather than
the entry of vegetative cells into host tissues. Therefore,
in the time period immediately after spore germination, the
vegetative bacilli will not have initiated protease secretion
and may therefore be increasingly susceptible to LL-37-mediated
killing.
B. anthracis UM23-Cl2 spores (1 x 105 CFU/ml) were germinated in Mueller-Hinton medium at 37°C, and samples were taken at various time intervals to determine the proportion of germinated Bacillus spores. At each time point, the GI50 values were calculated to determine susceptibility to LL-37. Figure 4 shows that 90% of the spores germinated within 1.5 h. At the same time, the susceptibility to LL-37 was a GI50 of 7 µg/ml, which is significantly lower than that of the exponentially growing bacteria (GI50, 63 µg/ml). Resistance to LL-37 increased gradually at the onset of vegetative growth, reaching a GI50 of 20 µg/ml after 6 h. However, the onset of exponential growth corresponded to a significant increase in LL-37 resistance, with GI50 values of 65 µg/ml after 7.5 h.

DISCUSSION
In humans, LL-37 is expressed within mast cells, within neutrophils,
and by epithelial cells at a wide range of sites, including
the skin, lung, gastrointestinal tract, urogenital tract, and
oral tract (
14,
17). LL-37 is widely secreted in wound, sweat,
and airway surface fluids. At mucosal surfaces the baseline
level of LL-37 is approximately 2 µg/ml. However, expression
is markedly upregulated during infection, during inflammation,
or following exposure to proinflammatory mediators (
29). Studies
that have used gene therapy and gene-knockout studies have demonstrated
that LL-37 performs a key function in the innate immune response
against invading microorganisms (
4,
28).
LL-37 is described as a membrane-active agent. The direct antimicrobial activity is mediated by disruption of the target cell lipid bilayer via toroidal pore formation, leading to osmotic lysis and cell death (20). LL-37 is active against the cell membranes of a broad spectrum of bacteria, fungi, and enveloped viruses (3). However, in addition to direct antimicrobial activity, LL-37 also performs a variety of other functions with the innate immune system, including the neutralization of bacterial lipopolysaccharide (24); chemotaxis of neutrophils, mast cells, monocytes, and T cells (27, 50); and activation of both airway epithelial cells and dendritic cells (8, 36).
Pathogens have a range of strategies that they use to resist the activities of antimicrobial peptides (31). These include modulation of the cell wall charge (9, 32), efflux pumps (39), and alteration of the fluidity of the cell membrane and cleavage by extracellular proteases (15, 30, 35, 40). Evidence in the scientific literature suggests that the proteases secreted by pathogenic organisms, including P. aeruginosa, E. faecalis, and S. pyogenes, confer resistance to antimicrobial peptides such as LL-37 (35). Here we have shown that B. anthracis cultures in vitro secrete metalloproteases, which provide resistance to the bactericidal effects of LL-37. These metalloproteases may therefore play a role in the virulence of B. anthracis, especially in infections caused by the airborne route.
The classical description of virulence in B. anthracis is based primarily on the activities of two plasmid-borne virulence determinants: the anthrax toxins and the antiphagocytic capsule. In this study we demonstrate that B. anthracis also possesses a chromosomally located gene(s) that encodes extracellular proteases. This proteolytic activity is able to degrade the host antimicrobial peptide LL-37 and may therefore contribute to virulence.
Although, B. anthracis is more resistant to LL-37 than other members of the Bacillus genus, LL-37 was bactericidal for B. anthracis at concentrations greater than 125 µg/ml. Infections with B. anthracis are mediated by spores, which lack protease secretion and, as such, are extremely susceptible to LL-37-mediated killing at this early stage in the infection process.
Antimicrobial peptides such as LL-37 show considerable potential for the treatment of infectious diseases. However, as with all antimicrobial therapeutics, the effects of pathogen resistance must be investigated. The escalating prevalence of bacterial strains resistant to conventional antibiotics has prompted a search for new therapeutic agents. LL-37 has many advantages over conventional antibiotic regimens, including a broad spectrum of activity and a rapid rate of killing, and fewer problems associated with classical antibiotic resistance mechanisms.

FOOTNOTES
* Corresponding author. Mailing address: Biomedical Sciences, Dstl Porton Down, Salisbury, Wiltshire SP4 0JQ, United Kingdom. Phone: 44-1980-613262. Fax: 44-1980-614307. E-mail:
jethwaite{at}dstl.gov.uk.


REFERENCES
1 - Agerberth, B. H., J. Gunne, P. Odeberg, H. Kogner, H. G. Boman, and G. H. Gudmundsson. 1995. FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis. Proc. Natl. Acad. Sci. USA 92:195-199.[Abstract/Free Full Text]
2 - Aronson, A. I., C. Bell, and B. Fulroth. 2005. Plasmid-encoded regulator of extracellular proteases in Bacillus anthracis. J. Biol. Chem. 187:3133-3138.
3 - Bals, R. 2000. Epithelial antimicrobial peptides in host defense against infection. Respir. Res. 1:141-150.[Medline]
4 - Bals, R., D. J. Weiner, A. D. Moscioni, R. L. Meegalla, and J. M. Wilson. 1999. Augmentation of innate host defense by expression of a cathelicidin antimicrobial peptide. Infect. Immun. 67:6084-6089.[Abstract/Free Full Text]
5 - Bals, R., X. Wang, M. Zasloff, and J. M. Wilson. 1998. The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surface. Proc. Natl. Acad. Sci. USA 95:9541-9546.[Abstract/Free Full Text]
6 - Bowdish, D. M. E., D. J. Davidson, M. G. Scott, and R. E. W. Hancock. 2005. Immunomodulatory activities of small host defense peptides. Antimicrob. Agents Chemother. 49:1727-1732.[Abstract/Free Full Text]
7 - Bradaric, N., and V. Pundapolic. 1992. Cutaneous anthrax due to penicillin-resistant Bacillus anthracis transmitted by an insect bite. Lancet 340:306-307.[Medline]
8 - Davidson, D. J., A. J. Currie, G. S. D. Reid, D. M. E. Bowdish, K. L. MacDonald, R. C. Ma, R. E. W. Hancock, and D. P. Speert. 2004. The cationic antimicrobial peptide LL-37 modulates dendritic cell differentiation and dendritic cell-induced T cell proliferation. J. Immunol. 172:1146-1156.[Abstract/Free Full Text]
9 - Ernst, R. K., E. C. Yi, L. Guo, K. B. Lim, J. L. Burns, M. Hackett, and S. I. Miller. 1999. Specific lipopolysaccharide found in cystic fibrosis airway Pseudomonas aeruginosa. Science 286:1561-1565.[Abstract/Free Full Text]
10 - Fellows, P. F. 1996. A survey of worldwide strains of Bacillus anthracis. Salisbury Med. Bull. Special Suppl. 87:31-33.
11 - Fouet, A., J.-C. Sirard, and M. Mock. 1995. Virulence gene determinants. Salisbury Med. Bull. Special Suppl. 87:84-85.
12 - Frohm, M., B. Agerberth, G. Ahangari, M. Stahle-Backdahl, S. Liden, H. Wigzell, H., and G. H. Gudmundsson. 1997. The expression of the gene coding for the antibacterial peptide LL-37 is induced in human keratinocytes during inflammatory disorders. J. Biol. Chem. 272:15258-15263.[Abstract/Free Full Text]
13 - Green, B. D., L. Battisti, T. M. Koehler, C. B. Thorne, and B. F. Ivins. 1985. Demonstration of a capsule plasmid in Bacillus anthracis. Infect. Immun. 49:291-297.[Abstract/Free Full Text]
14 - Gudmundsson, G. H., and B. Agerberth. 1999. Neutrophil antibacterial peptides, multifunctional effector molecules in the mammalian immune system. J. Immunol. Methods 232:45-54.[CrossRef][Medline]
15 - Guina, T., E. C. Yi, H. L. Wang, M. Hackett, and S. I. Miller. 2000. A PhoP-regulated outer membrane protease of Salmonella enterica serovar Typhimurium promotes resistance to
-helical antimicrobial peptides. J. Bacteriol. 182:4077-4086.[Abstract/Free Full Text] 16 - Hancock, R. E. W. 1997. Peptide antibiotics. Lancet 349:418-422.[CrossRef][Medline]
17 - Hancock, R. E. W., and G. Diamond. 2000. Cationic antimicrobial peptides: a major element in mammalian innate immune defences against infection. Trends Microbiol. 8:402-410.[CrossRef][Medline]
18 - Hancock, R. E. W., and M. G. Scott. 2000. The role of antimicrobial peptides in animal defenses. Proc. Natl. Acad. Sci. USA 97:8856-8861.[Abstract/Free Full Text]
19 - Hancock, R. E. W., and R. Lehrer. 1998. Cationic peptides: a new source of antibiotics. Trends Biotechnol. 16:82-88.[CrossRef][Medline]
20 - Henzler-Wildman, K. A., G. V. Martinez, M. F. Brown, and A. Ramamoorthy. 2004. Perturbation of the hydrophobic core of lipid bilayers by human antimicrobial peptide LL-37. Biochemistry 43:8459-8469.[CrossRef][Medline]
21 - Inglesby, T. V., D. A. Henderson, J. G. Bartlett, M. S. Ascher, E. Eitzen, A. M. Friedlander, J. Hauer, J. McDade, M. T. Osterholm, T. O'Toole, G. Parker, T. M. Perl, P. K. Russell, and K. Tonat. 1999. Anthrax as a biological weaponmedical and public health management. JAMA 281:1735-1745.[Abstract/Free Full Text]
22 - Ivins, B. E., P. F. Fellows, and G. O. Nelson. 1994. Efficacy of a standard human anthrax vaccine against Bacillus anthracis spore challenge in guinea-pigs. Vaccine 12:872-874.[CrossRef][Medline]
23 - Kunst, F., T. Msadek, J. Bignon, and G. Rapoport. 1994. The DegS/DegU and ComP/ComA two-component systems are part of a network controlling degradative enzyme synthesis and competence in Bacillus subtilis. Res. Microbiol. 145:393-402.[Medline]
24 - Larrick, J., M. Hirata, R. Balint, J. Lee, J. Zhong, and S. Wright. 1995. Human CAP18: a novel antimicrobial lipopolysaccharide-binding protein. Infect. Immun. 63:1291-1297.[Abstract]
25 - Mikesell, P., B. E. Ivins, J. D. Ristroph, and T. M. Dreier. 1983. Evidence for plasmid-mediated toxin production in Bacillus anthracis. Infect. Immun. 39:371-376.[Abstract/Free Full Text]
26 - Miyoshi, S., and S. Shinoda. 2000. Microbial metalloproteases and pathogenesis. Microbes Infect. 2:91-98.[CrossRef][Medline]
27 - Niyonsaba, F., K. Iwabuchi, A. Someya, M. Hirata, H. Matsuda, H. Ogawa, and I. Nagaoka. 2002. A cathelicidin family of human antibacterial peptide LL-37 induces mast cell chemotaxis. Immunology 106:20-26.[CrossRef][Medline]
28 - Nizet, V., T. Ohtake, X. Lauth, J. Trowbridge, J. Rudisill, R. A. Dorschner, V. Pestonjamasp, J. Piraino, K. Huttner, and R. L. Gallo. 2001. Innate antimicrobial peptide protects the skin from invasive bacterial infection. Nature 414:454-457.[CrossRef][Medline]
29 - Ong, P. Y., T. Ohtake, C. Brandt, I. Strickland, M. Boguniewicz, T. Ganz, R. L. Gallo, and D. Y. Leung. 2002. Endogenous antimicrobial peptides and skin infections in atopic dermatitis. N. Engl. J. Med. 347:1151-1160.[Abstract/Free Full Text]
30 - Park, P. W., G. B. Pier, M. T. Hinkes, and M. Bernfield. 2001. Exploitation of syndecan-1 shedding by Pseudomonas aeruginosa enhances virulence. Nature 411:98-102.[CrossRef][Medline]
31 - Peschel, A. 2002. How do bacteria resist human antimicrobial peptides? Trends Microbiol. 10:179-186.[CrossRef][Medline]
32 - Peschel, A., and L. V. Collins. 2001. Staphylococcal resistance to antimicrobial peptides of mammalian and bacterial origin. Peptides 22:1651-1659.[CrossRef][Medline]
33 - Popov, S. G., T. G. Popova, S. Hopkins, R. S. Weinstein, R. MacAfee, K. J. Fryxell, V. Chandhoke, C, Bailey, and K. Alibek. 2005. Effective antiprotease-antibiotic treatment of experimental anthrax. BMC Infect. Dis. 5:25.[CrossRef][Medline]
34 - Schaffer, P. 1969. Sporulation and the production of antibiotics, enzymes and exotoxins. Bacteriol. Rev. 33:48-57.[Free Full Text]
35 - Schmidtchen, A., I.-M. Frick, E. Andersson, H. Tapper, and L. Björck. 2002. Proteinases of common pathogenic bacteria degrade and inactivate the antibacterial peptide LL-37. Mol. Microbiol. 46:157-168.[CrossRef][Medline]
36 - Scott, M. G., D. J. Davidson, M. R. Gold, D. Bowdish, and R. E. W. Hancock. 2002. The human antimicrobial peptide LL-37 is a multifunctional modulator of the innate immune responses. J. Immunol. 169:3883-3891.[Abstract/Free Full Text]
37 - Scott, M. G., and R. E. W. Hancock. 2000. Cationic antimicrobial peptides and their multifunctional role in the immune system. Crit. Rev. Immunol. 20:407-431.[Medline]
38 - Semenov, A., J. E. Olson, and P. J. Rosenthal. 1998. Antimalarial synergy of cysteine and aspartic protease. Antimicrob. Agents Chemother. 42:2254-2258.[Abstract/Free Full Text]
39 - Shafer, W. M., X. D. Qu, A. J. Waring, and R. I. Lehrer. 1998. Modulation of Neisseria gonorrhoeae susceptibility to vertebrate antibacterial peptides due to a member of the resistance/nodulation/division efflux pump family. Proc. Natl. Acad. Sci. USA 95:1829-1833.[Abstract/Free Full Text]
40 - Sieprawska-Lupa, M., P. Mydel, K. Krawczyk, K. Wojcik, M. Puklo, B. Lupa, P. Suder, J. Silberring, M. Reed, J. Pohl, W. Shafer, F. McAleese, T. Foster, J. Travis, and J. Potempa. 2004. Degradation of human antimicrobial peptide LL-37 by Staphylococcus aureus-derived proteinases. Antimicrob. Agents Chemother. 48:4673-4679.[Abstract/Free Full Text]
41 - Sorensen, O., K. Arnljots, J. B. Cowland, D. F. Bainton, and N. Borregaard. 1997. The human antibacterial cathelicidin, hCAP-18, is synthesized in myelocytes and metamyelocytes and localized to specific granules in neutrophils. Blood 90:2796-2803.[Abstract/Free Full Text]
42 - Stepanov, A. S., K. R. Klimpel, and S. H. Leppla. 1996. Extracellular proteases in Bacillus anthracis. Salisbury Med. Bull. Special Suppl. 87:87.
43 - Stepanov, A. S., N. I. Mikshis, and M. F. Bolotnikova. 1996. Role of chromosomally-encoded factors in virulence of Bacillus anthracis for mice and guinea pigs. Salisbury Med. Bull. Special Suppl. 87:86.
44 - Travis, J., and J. Potempa. 2000. Bacterial proteinases as targets for the development of second-generation antibiotics. Biochim. Biophys. Acta 1477:35-50.[CrossRef][Medline]
45 - Tremblay, C., D. P. Merrill, T. C. Chou, and M. S. Hirsch. 1999. Interactions among combinations of two and three protease inhibitors against drug-susceptible and drug-resistant HIV-1 isolates. J. Acquir. Immune Defic. Syndr. 15:430-436.
46 - Turnbull, P. C. B., and J. M. Kramer. 1995. Bacillus, p. 349-356. In P. R. Murray, E. J. Baron, M. A. Pfaller, F. C. Tenover, and R. H. Yolken (ed.), Manual of clinical microbiology, 6th ed. American Society for Microbiology, Washington, D.C.
47 - Uchida, I., T. Sekizaki, K. Hashimoto, and N. Terakado. 1985. Association of the encapsulation of Bacillus anthracis with a 60 megadalton plasmid. J. Gen. Microbiol. 131:363-367.[Abstract/Free Full Text]
48 - Welkos, S. L., N. J. Vietri, and P. H. Gibbs. 1993. Non-toxigenic derivatives of the Ames strain of Bacillus anthracis are fully virulent for mice: role of plasmid pX02 and chromosome in strain-dependent virulence. Microb. Pathog. 14:381-388.[CrossRef][Medline]
49 - Wu, M., and R. E. W. Hancock. 1999. Improved derivatives of bactenecin, a cyclic dodecameric antimicrobial cationic peptide. Antimicrob. Agents Chemother. 43:1274-1276.[Abstract/Free Full Text]
50 - Yang, D., Q. Chen, A. P., Schmidt, G. M. Anderson, J. M. Wang, J. Wooters, J. J. Oppenheim, and O. Chertov. 2000. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilises formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J. Exp. Med. 192:1069-1074.[Abstract/Free Full Text]
Antimicrobial Agents and Chemotherapy, July 2006, p. 2316-2322, Vol. 50, No. 7
0066-4804/06/$08.00+0 doi:10.1128/AAC.01488-05
Copyright © 2006, American Society for Microbiology. All Rights Reserved.
This article has been cited by other articles:
-
Kooi, C., Sokol, P. A.
(2009). Burkholderia cenocepacia zinc metalloproteases influence resistance to antimicrobial peptides. Microbiology
155: 2818-2825
[Abstract]
[Full Text]
-
Thwaite, J. E., Humphrey, S., Fox, M. A., Savage, V. L., Laws, T. R., Ulaeto, D. O., Titball, R. W., Atkins, H. S.
(2009). The cationic peptide magainin II is antimicrobial for Burkholderia cepacia-complex strains. J Med Microbiol
58: 923-929
[Abstract]
[Full Text]
-
Lisanby, M. W., Swiecki, M. K., Dizon, B. L. P., Pflughoeft, K. J., Koehler, T. M., Kearney, J. F.
(2008). Cathelicidin Administration Protects Mice from Bacillus anthracis Spore Challenge. J. Immunol.
181: 4989-5000
[Abstract]
[Full Text]
-
Karlsson, C., Andersson, M.-L., Collin, M., Schmidtchen, A., Bjorck, L., Frick, I.-M.
(2007). SufA a novel subtilisin-like serine proteinase of Finegoldia magna. Microbiology
153: 4208-4218
[Abstract]
[Full Text]