Previous Article | Next Article 
Antimicrobial Agents and Chemotherapy, February 2008, p. 638-642, Vol. 52, No. 2
0066-4804/08/$08.00+0 doi:10.1128/AAC.01271-07
Copyright © 2008, American Society for Microbiology. All Rights Reserved.
Resistance of Porphyromonas gingivalis ATCC 33277 to Direct Killing by Antimicrobial Peptides Is Protease Independent
Gilad Bachrach,1*
Hamutal Altman,1
Paul E. Kolenbrander,2
Natalia I. Chalmers,2
Michal Gabai-Gutner,1
Amram Mor,3
Michael Friedman,4 and
Doron Steinberg1
Institute of Dental Sciences, The Hebrew University-Hadassah School of Dental Medicine, The Hebrew University of Jerusalem, Jerusalem, Israel,1
National Institute of Dental and Craniofacial Research, National Institutes of Health, Building 30, Room 310, Bethesda, Maryland 20892,2
Laboratory of Antimicrobial Peptides Investigation, Department of Biotechnology and Food Engineering, Technion-Israel Institute of Technology Haifa, Haifa, Israel,3
Department of Pharmaceutics, School of Pharmacy, Faculty of Medicine, The Hebrew University of Jerusalem, Jerusalem, Israel4
Received 1 October 2007/
Returned for modification 6 November 2007/
Accepted 3 December 2007

ABSTRACT
Antimicrobial peptides are short, positively charged, amphipathic
peptides that possess a wide spectrum of antimicrobial activity
and have an important role in the host's innate immunity. Lack
of, or dysfunctions in, antimicrobial peptides have been correlated
with infectious diseases, including periodontitis.
Porphyromonas gingivalis, a gram-negative anaerobe and a major pathogen associated
with periodontal diseases, is resistant to antimicrobial peptides
of human and nonhuman origin, a feature that likely contributes
to its virulence. Expressing a robust proteolytic activity,
P. gingivalis hydrolyzes antimicrobial peptides. In this study,
P. gingivalis inactivated three antimicrobial peptides, while
a
D-enantiomer was resistant to degradation.
P. gingivalis was
resistant to the protease-resistant
D-enantiomer peptide, and
importantly, a protease-deficient
P. gingivalis mutant was also
resistant to the antimicrobial peptide. Finally, the binding
of a fluorescently labeled antimicrobial peptide to protease-deficient
P. gingivalis was much weaker than the binding of susceptible
Escherichia coli. Our results suggest that the resistance of
P. gingivalis ATCC 33277 to direct killing by antimicrobial
peptides is protease independent and results (at least partially)
from the low affinity of antimicrobial peptides to
P. gingivalis.

INTRODUCTION
Antimicrobial peptides are components of the innate immunity
that mediate a broad range of antimicrobial activity. More than
800 cationic peptides have been described for insects, vertebrates,
and humans (
www.bbcm.units.it/
tossi/pag1.htm). Though highly
diverse, antimicrobial peptides share the features of a net
positive charge and the ability to adopt an amphipathic structure
in solution. The peptides are believed to kill bacteria through
a multiple hit mechanism, whose targets can include the outer
and inner membranes as well as cytoplasmic components (
16).
Thus, antimicrobial peptides seem to escape many of the bacterial
drug resistance mechanisms and often show a synergistic effect
with conventional antibiotics (
44).
In mammals, antimicrobial peptides were also found to function as immunomodulators of the innate immune system that alter gene expression in host cells, induce or modulate chemokine and cytokine production, and elicit or inhibit a proinflammatory response (3, 38, 43). Since the recognition of their immunoregulatory functions, antimicrobial peptides are often referred to as host defense peptides.
In the human oral cavity, several kinds of antimicrobial peptides are found. These include
- and β-defensins, histatins, and LL-37 (6, 20, 34). Periodontal disease is a common bacterium-induced inflammatory disease (36) in which the tooth-supporting tissues are attacked. Deficiency of LL-37 in neutrophils and in saliva has been correlated with the occurrence of severe periodontal disease (34).
Porphyromonas gingivalis, the oral pathogen most associated with chronic periodontal disease (40), is resistant to many antimicrobial peptides (1, 15, 27). P. gingivalis is known for its robust proteolytic activity, in particular, the expression of extracellular Arg-gingipain and Lys-gingipain cysteine proteases that cleave at the C termini of arginine and lysine, respectively. Arginine and lysine, both being positively charged amino acids, are highly represented in cationic antimicrobial peptides. Therefore, it was rational to hypothesize that gingipains are important for the resistance of P. gingivalis to antimicrobial peptides. Our results, however, suggest that although P. gingivalis readily digests antimicrobial peptides, its ability to escape killing by antimicrobial peptides is independent of its proteolytic capacity.
Peptide synthesis is relatively straightforward; therefore, antimicrobial peptides present an appealing approach for controlling microbial pathogens. Better understanding of the mechanisms of bacterial resistance to antimicrobial peptides provides insight for the development of effective antibacterial therapies.

MATERIALS AND METHODS
Peptides.
The three antimicrobial peptides used in this study have been
described by us before (
1). Dhvar4 (KRLFKKLLFSLRKY-NH2; molecular
weight [MW], 1,839.3) is a derivative of human histatin 5, a
member of a family of antifungal and antibacterial histidine-rich
proteins secreted from salivary glands (
13,
17-
19). K
4-S4(1-15)a
(ALWKTLLKKVLKAAA-NH
2; MW, 1,653.1) is a short derivative of
dermaseptin S4, a member of the dermaseptin family of antimicrobial
peptides, isolated from the skin of tree frogs (
11,
23). Human
LL-37 ([LL-37, 37 aa]; MW, 4,493.3) is
the only member of the cathelicidin family in humans and is
cleaved and released from the C terminus of the cathelicidin
hCAP18 propeptide secreted from granules of neutrophils (
41)
and from epithelial cells (
2).
We synthesized the peptides by the solid-phase method (12), applying Fmoc (9-fluorenylmethyloxycarbonyl) active ester chemistry on an Applied Biosystems model 433A peptide synthesizer (Foster City, CA) as described before (25). The crude peptides were purified to more than 95% chromatographic homogeneity by reversed-phase high-performance liquid chromatography (Alliance-Waters, Milford, MA). The purified peptides were subjected to amino acid analysis and electrospray mass spectrometry (Micromass ZQ; Waters, Milford, MA) to confirm their composition and were stored as lyophilized powder at –20°C.
Bacterial strains and growth conditions.
Streptococcus mutans ATCC 27351 was cultured in brain heart infusion broth (BHI) (Difco, MD) at 37°C in an atmosphere enriched with 5% CO2. P. gingivalis ATCC 33277 was grown in Wilkin's broth (Oxoid, United Kingdom). P. gingivalis KDP136 (P. gingivalis ATCC 33277 mutant inactivated in rgpA, rgpB, and kgp), generously supplied by Koji Nakayama (39), was grown in enriched BHI broth (containing, per liter, 37 g of BHI [Difco], 5 g of yeast extract [Difco], 1 g of cysteine, 5 mg of hemin, and 1 mg of vitamin K1) supplemented with chloramphenicol, 20 µg/ml; erythromycin, 10 µg/ml; and tetracycline, 0.7 µg/ml. P. gingivalis strains were grown in jars containing an anaerobic atmosphere generation system (Oxoid, United Kingdom). Aggregatibacter (formerly Actinobacillus) actinomycetemcomitans ATCC 29523 (26) was cultured in 0.5% yeast extract, 1.5% Bacto tryptone, 0.75% D-glucose, 0.25% NaCl, 0.075% L-cysteine, 0.05% sodium thioglycolate, and 4% NaHCO3 at 37°C in 5% CO2. Escherichia coli ATCC 25922 was grown in BHI under aerobic conditions.
Effect of preincubation with bacterial culture supernatant on peptide antimicrobial activity.
Cultures of P. gingivalis or A. actinomycetemcomitans were grown to stationary phase and centrifuged for 10 min at 10,000 x g in a microcentrifuge (Eppendorf, Germany). Supernatants were collected and filter sterilized (0.2 µm; Whatman Schleicher & Schuell, Germany). Peptides K4-S4(1-15)a (100 µg/ml final concentration), Dhvar4a (800 µg/ml), LL-37 (2,000 µg/ml), and D-K4-S4(1-15)a (100 µg/ml) were incubated with 20% (final) P. gingivalis or A. actinomycetemcomitans filtrates for the indicated time.
Overnight cultures of bacteria were diluted 1:10 (for S. mutans) or 1:5,000 (for E. coli) in culture medium, sonicated for 1 min in a sonication bath (Transsonic T 640; ELMA, Germany), and distributed in aliquots of 190 µl into 96-well plates (Nunc, Denmark). Ten microliters of supernatant-treated peptides was added [K4-S4(1-15)a and Dhvar4a were added to S. mutans cultures, and LL-37 was added to an E. coli culture]. Plates were incubated at the appropriate growth conditions. Bacterial growth was determined by measurements of the optical density at 650 nm (OD650) using a ThermoMax microplate spectrophotometer (Molecular Devices). Percent inhibition of bacterial growth by the supernatant-treated peptides was calculated and compared to that for cells where fresh medium was added instead of peptides (no peptide, 0% growth inhibition) and controls where peptides were preincubated with fresh medium instead of culture supernatant (nontreated peptide, 100% growth inhibition). Data are means and standard deviations of three independent experiments performed in triplicate.
The MIC in planktonic bacteria was determined using a microdilution assay as described previously (1).
Fluorescent labeling of peptides.
Peptides (1.5 mg) were labeled using the Alexa Fluor 546 protein labeling kit (Molecular Probes, Oregon) and purified using Bio-Gel P-2 (Bio-Rad, Hercules, CA). The first 0.5-ml elution fraction collected (containing the majority of the labeled peptide) was used. Quantification of the labeled LL-37 was measured with a NanoDrop ND-1000 UV-Vis spectrophotometer at 226 nm (NanoDrop Technologies, Wilmington, DE). A calibration curve was made using known amounts of LL-37 at 226 nm to enable estimation of the concentration of the purified, fluorescently labeled LL-37.
Attachment of fluorescently labeled peptide to P. gingivalis and to E. coli.
Overnight bacterial cultures were diluted (1:5 for P. gingivalis KDP136 and 1:100 for E. coli ATCC 25922) and grown to an OD600 of approximately 1 (approximately 8 h for P. gingivalis and 3 h for E. coli). Cells were sedimented for 3 min at 10,000 x g and brought to an OD600 of 1 in phosphate-buffered saline (PBS). Labeled peptides (0 [negative control], 1, 4, or 16 µl [estimated concentration 0.8 mg/ml]) were added to 100 µl of bacterial suspension and incubated at room temperature for 10 min. Cells were washed in 0.5 ml PBS, resuspended in 0.1 ml PBS, and transferred to wells of a 96-well microtiter plates (Nunc, Denmark). Fluorescence of bacterium-attached labeled peptide was determined by using a fluorescence microplate reader (excitation, 544 nm; emission, 590 nm; FLUOstar+ Galaxy; BMG Laboratories, Offenburg, Germany). In order to test the integrity of peptide incubated with P. gingivalis KDP136, the supernatant of the labeling reaction mixture (containing unbound peptide) was used to react with E. coli ATCC 25922 as described above. Experiments were performed with minimal exposure to light. Means and standard deviations of three independent experiments are presented. Two microliters of each adherence reaction mixture was placed on a microscope slide and analyzed using an Axiovert 200, SensiCam Zeiss, PCO microscope (Zeiss, Germany).

RESULTS
Peptide antimicrobial activity diminishes following incubation with culture supernatant prepared from P. gingivalis.
Previous results by others (
15,
21) and ourselves (
1) demonstrated
that most tested
P. gingivalis strains showed resistance to
antimicrobial peptides. The fact that
P. gingivalis is a very
proteolytic organism suggested that its resistance to antimicrobial
peptides might stem from its ability to hydrolyze them. Proteolysis
has been suggested before as a resistance mechanism against
antimicrobial peptides in yeast (
Candida albicans) (
35) and
bacteria (
14,
37), including
P. gingivalis (
10).
Previously, we reported that P. gingivalis is resistant to the antimicrobial peptides K4-S4(1-15)a, LL-37, and Dhvar4 (1). To test whether P. gingivalis can inactivate these three peptides, the growth inhibitions of S. mutans [susceptible to K4-S4(1-15)a and Dhvar4] and E. coli (susceptible to LL-37) (1) were tested with or without preincubation of the peptides with protease-containing P. gingivalis culture supernatant. As can be seen in Fig. 1A, the antimicrobial activity of all three antimicrobial peptides was diminished following preincubation with the culture supernatant prepared from P. gingivalis ATCC 33277 in a time-dependent manner. Culture supernatant prepared from the nonproteolytic periodontal pathogen A. actinomycetemcomitans in a manner similar to that described above did not reduce the antimicrobial activity of the peptides (Fig. 1B).
D-Enantiomer conformation of K4-S4(1-15)a renders resistance to inactivation by culture supernatants of P. gingivalis ATCC 33277.
Peptides synthesized using
D-amino acids acquire an increased
resistance to proteolysis by bacterial proteases. Unlike the
"parent" K
4-S4(1-15)a peptide, the
D-enantiomer retained anti-
S. mutans activity following 8 h of incubation with culture supernatant
prepared from
P. gingivalis (Fig.
2). This observation suggested
that the peptide in the
D-conformation was resistant to degradation
by
P. gingivalis.
P. gingivalis is resistant to the D-enantiomer of K4-S4(1-15)a.
Although
D-K
4-S4(1-15)a remained effective against
S. mutans,
even after an 8-h preincubation with
P. gingivalis supernatant,
P. gingivalis ATCC 33277 remained resistant to D-K
4-S4(1-15)a
(Fig.
3). Some inhibition of D-K
4-S4(1-15)a could be detected
at 100 µg/ml; however, this effect was not observed at
higher concentrations. This result suggested that the resistance
of
P. gingivalis ATCC 33277 to K
4-S4(1-15)a is independent of
its proteolytic capacity.
Binding of fluorescently labeled peptides to P. gingivalis.
Fluorescent labeling of the K
4-S4(1-15)a peptide abolished its
bacterial binding capacity (data not shown), presumably because
of steric interference by the chromophore, which has a significant
molecular mass (410 Da) compared to that of the short K
4-S4(1-15)a
peptide (1,653 Da). However, fluorescently labeled LL-37 peptide
bound
E. coli ATCC 25922 in a dose-dependent manner (Fig.
4A and C).
Fluorescently labeled LL-37 was immediately digested by
P. gingivalis ATCC 33277 (data not shown). Therefore, a protease-deficient
P. gingivalis strain (KDP136) (
39) was used to determine the
binding of LL-37 to
P. gingivalis. Unlike
E. coli, which exhibited
strong binding to LL-37 (Fig.
4A and C), the protease-deficient
P. gingivalis KDP136 strain demonstrated weak binding to the
fluorescently labeled LL-37 peptide (Fig.
4A). Poor binding
to
P. gingivalis KDP136 (Fig.
4D) did not result from peptide
degradation because the unbound peptide that remained in the
incubation supernatant after removal of
P. gingivalis KDP136
by centrifugation bound to
E. coli with an affinity similar
to that of the peptide not incubated with
P. gingivalis KDP136
(Fig.
4B).
Protease-deficient P. gingivalis KDP136 is resistant to LL-37.
Though not capable of degrading LL-37 (Fig.
4B), the protease-deficient
P. gingivalis KDP136 mutant was found to be resistant to the
LL-37 antimicrobial peptide (MIC higher than 200 µg/ml
[data not shown]), supporting the above results indicating that
the resistance of
P. gingivalis to direct killing by antimicrobial
peptides is protease independent.

DISCUSSION
P. gingivalis is a major pathogen involved in periodontal disease
that flourishes in the gingival crevice, although it is bathed
with antimicrobial peptides (
6,
45). Indeed, in a recent study
(
1),
P. gingivalis was found to be resistant to the three tested
antimicrobial peptides (from human and nonhuman origins). Resistance
to antimicrobial peptides is likely to contribute to the virulence
of
P. gingivalis. The high proteolytic capacity of
P. gingivalis suggested that peptide degradation is the mechanism by which
P. gingivalis resists host antimicrobial peptides. Indeed, in
this study, wild-type
P. gingivalis inactivated all three antimicrobial
peptides in a time-dependent manner. Of the three antimicrobial
peptides, the activity of human LL-37 was reduced the most and
most rapidly (Fig.
1A). This might result from its increased
length (37 amino acids) and its abundance of lysines (
6) and
arginines (
5) that are the cleavage sites for the Arg- and Lys-gingipains
of
P. gingivalis. Dhvar4 (a derivative of the human salivary
histatin 5 antimicrobial peptide) is 14 amino acids long and
contains four lysines and two arginines and was more susceptible
to proteolysis by
P. gingivalis than was K
4-S4(1-15)a (an analog
of the amphibian dermaseptin S4 peptide), which is 15 amino
acids long but contains only four lysines (Fig.
1A).
The fact that wild-type P. gingivalis ATCC 33277 is resistant to D-K4-S4(1-15)a (Fig. 3), the protease-resistant D-enantiomer of K4-S4(1-15)a, and that its protease-deficient mutant progeny P. gingivalis KDP136 retains resistance to LL-37, although it is incapable of degrading it, testify that the resistance of P. gingivalis ATCC 33277 to direct killing by these antimicrobial peptides is independent of protease activity. Rather, our results suggest that the resistance of P. gingivalis ATCC 33277 to antimicrobial peptides derives, at least in part, from its low affinity to these positively charged peptides (Fig. 4). Cationic antimicrobial peptides bind lipopolysaccharides (LPS) of gram-negative bacteria (32), and LPS structure has been shown to affect susceptibility or resistance to antimicrobial peptides (28). In accordance with our observations, it was suggested previously (9, 10) that the unique LPS structure of P. gingivalis that induces different host responses than those of most studied LPS (7, 24, 33) might contribute to its resistance to antimicrobial peptides. Alterations in LPS composition might also explain differences in antimicrobial susceptibility profiles observed among several strains of P. gingivalis (21). Modifications in LPS (9) or bacterial cell surfaces have previously been demonstrated to contribute to resistance to antimicrobial peptides in several bacterial pathogens, including Haemophilus influenzae (42), Staphylococcus aureus (8, 29, 30), and Pseudomonas aeruginosa (31). Treponema denticola is a periodontal pathogen that, in a manner similar to that of P. gingivalis, expresses robust proteolytic activity. The resistance of T. denticola to β-defensins was also shown to be associated with its unique cell surface structure that lacks LPS and demonstrated reduced defensin binding (4, 5).
In dental plaque, P. gingivalis is found in a closely packed interdigitated mixed-species biofilm. Though we demonstrated that the highly active gingipains of P. gingivalis are not essential for its resistance to direct killing by antimicrobial peptides, we propose (22) that the P. gingivalis proteases, by degrading local antimicrobial peptides, can provide protection to proximal, otherwise peptide-susceptible bacteria, such as Fusobacterium nucleatum (1) and A. actinomycetemcomitans (34). It also seems reasonable to speculate that in vivo, the degradation of local antimicrobial peptides by P. gingivalis disrupts the immunoregulatory functions of the peptides and assists P. gingivalis (and proximal plaque community species) in evading an otherwise orchestrated host immune response.

ACKNOWLEDGMENTS
We thank Koji Nakayama for generously providing
P. gingivalis KDP136 and Ronit Naor for her technical assistance.
This work was supported in part by the Israel Science Foundation (grant number 517/06) and, in part, by the United States-Israel Binational Science Foundation (grant number 2005084).

FOOTNOTES
* Corresponding author. Mailing address: Institute of Dental Sciences, The Hebrew University-Hadassah School of Dental Medicine, The Hebrew University of Jerusalem, Jerusalem, Israel. Phone: 972-2-6757117. Fax: 972-2-6758561. E-mail:
giladba{at}ekmd.huji.ac.il 
Published ahead of print on 17 December 2007. 

REFERENCES
1 - Altman, H., D. Steinberg, Y. Porat, A. Mor, D. Fridman, M. Friedman, and G. Bachrach. 2006. In vitro assessment of antimicrobial peptides as potential agents against several oral bacteria. J. Antimicrob. Chemother. 58:198-201.[Abstract/Free Full Text]
2 - Bals, R., X. Wang, M. Zasloff, and J. M. Wilson. 1998. The peptide antibiotic LL-37/hCAP-18 is expressed in epithelia of the human lung where it has broad antimicrobial activity at the airway surface. Proc. Natl. Acad. Sci. USA 95:9541-9546.[Abstract/Free Full Text]
3 - Bowdish, D. M., D. J. Davidson, Y. E. Lau, K. Lee, M. G. Scott, and R. E. Hancock. 2005. Impact of LL-37 on anti-infective immunity. J. Leukoc. Biol. 77:451-459.[Abstract/Free Full Text]
4 - Brissette, C. A., and S. A. Lukehart. 2007. Mechanisms of decreased susceptibility to β-defensins by Treponema denticola. Infect. Immun. 75:2307-2315.[Abstract/Free Full Text]
5 - Brissette, C. A., and S. A. Lukehart. 2002. Treponema denticola is resistant to human β-defensins. Infect. Immun. 70:3982-3984.[Abstract/Free Full Text]
6 - Brogden, K. A., J. M. Guthmiller, M. Salzet, and M. Zasloff. 2005. The nervous system and innate immunity: the neuropeptide connection. Nat. Immunol. 6:558-564.[Medline]
7 - Burns, E., G. Bachrach, L. Shapira, and G. Nussbaum. 2006. Cutting Edge: TLR2 is required for the innate response to Porphyromonas gingivalis: activation leads to bacterial persistence and TLR2 deficiency attenuates induced alveolar bone resorption. J. Immunol. 177:8296-8300.[Abstract/Free Full Text]
8 - Collins, L. V., S. A. Kristian, C. Weidenmaier, M. Faigle, K. P. Van Kessel, J. A. Van Strijp, F. Gotz, B. Neumeister, and A. Peschel. 2002. Staphylococcus aureus strains lacking D-alanine modifications of teichoic acids are highly susceptible to human neutrophil killing and are virulence attenuated in mice. J. Infect. Dis. 186:214-219.[CrossRef][Medline]
9 - Devine, D. A. 2003. Antimicrobial peptides in defence of the oral and respiratory tracts. Mol. Immunol. 40:431-443.[CrossRef][Medline]
10 - Devine, D. A., P. D. Marsh, R. S. Percival, M. Rangarajan, and M. A. Curtis. 1999. Modulation of antibacterial peptide activity by products of Porphyromonas gingivalis and Prevotella spp. Microbiology 145:965-971.[Abstract/Free Full Text]
11 - Feder, R., A. Dagan, and A. Mor. 2000. Structure-activity relationship study of antimicrobial dermaseptin S4 showing the consequences of peptide oligomerization on selective cytotoxicity. J. Biol. Chem. 275:4230-4238.[Abstract/Free Full Text]
12 - Fields, G. B., and R. L. Noble. 1990. Solid phase peptide synthesis utilizing 9-fluorenylmethoxycarbonyl amino acids. Int. J. Pept. Protein Res. 35:161-214.[Medline]
13 - Giacometti, A., O. Cirioni, W. Kamysz, G. D'Amato, C. Silvestri, M. S. Del Prete, A. Licci, A. Riva, J. Lukasiak, and G. Scalise. 2005. In vitro activity of the histatin derivative P-113 against multidrug-resistant pathogens responsible for pneumonia in immunocompromised patients. Antimicrob. Agents Chemother. 49:1249-1252.[Abstract/Free Full Text]
14 - Groenink, J., A. L. Ruissen, D. Lowies, W. van 't Hof, E. C. Veerman, and A. V. Nieuw Amerongen. 2003. Degradation of antimicrobial histatin-variant peptides in Staphylococcus aureus and Streptococcus mutans. J. Dent. Res. 82:753-757.[Abstract/Free Full Text]
15 - Guthmiller, J. M., K. G. Vargas, R. Srikantha, L. L. Schomberg, P. L. Weistroffer, P. B. McCray, Jr., and B. F. Tack. 2001. Susceptibilities of oral bacteria and yeast to mammalian cathelicidins. Antimicrob. Agents Chemother. 45:3216-3219.[Abstract/Free Full Text]
16 - Hancock, R. E., and H. G. Sahl. 2006. Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies. Nat. Biotechnol. 24:1551-1557.[CrossRef][Medline]
17 - Helmerhorst, E. J., I. M. Reijnders, W. van't Hof, I. Simoons-Smit, E. C. Veerman, and A. V. Amerongen. 1999. Amphotericin B- and fluconazole-resistant Candida spp., Aspergillus fumigatus, and other newly emerging pathogenic fungi are susceptible to basic antifungal peptides. Antimicrob. Agents Chemother. 43:702-704.[Abstract/Free Full Text]
18 - Helmerhorst, E. J., W. van't Hof, P. Breeuwer, E. C. Veerman, T. Abee, R. F. Troxler, A. V. Amerongen, and F. G. Oppenheim. 2001. Characterization of histatin 5 with respect to amphipathicity, hydrophobicity, and effects on cell and mitochondrial membrane integrity excludes a candidacidal mechanism of pore formation. J. Biol. Chem. 276:5643-5649.[Abstract/Free Full Text]
19 - Helmerhorst, E. J., W. Van't Hof, E. C. Veerman, I. Simoons-Smit, and A. V. Nieuw Amerongen. 1997. Synthetic histatin analogues with broad-spectrum antimicrobial activity. Biochem. J. 326:39-45.[Medline]
20 - Hosokawa, I., Y. Hosokawa, H. Komatsuzawa, R. B. Goncalves, N. Karimbux, M. H. Napimoga, M. Seki, K. Ouhara, M. Sugai, M. A. Taubman, and T. Kawai. 2006. Innate immune peptide LL-37 displays distinct expression pattern from beta-defensins in inflamed gingival tissue. Clin. Exp. Immunol. 146:218-225.[CrossRef][Medline]
21 - Joly, S., C. Maze, P. B. McCray, Jr., and J. M. Guthmiller. 2004. Human beta-defensins 2 and 3 demonstrate strain-selective activity against oral microorganisms. J. Clin. Microbiol. 42:1024-1029.[Abstract/Free Full Text]
22 - Kolenbrander, P. E., N. S. Jakubovics, N. I. Chalmers, and G. Bachrach. 2007. Coaggregation and distance-critical communication, p. 89-100. In K. A. Brogden, F. C. Minion, N. Cornick, T. B. Stanton, Q. Zhang, L. K. Nolan, and M. J. Wannemuehler (ed.), Virulence mechanisms of bacterial pathogens, 4th ed. ASM Press, Washington, DC.
23 - Krugliak, M., R. Feder, V. Y. Zolotarev, L. Gaidukov, A. Dagan, H. Ginsburg, and A. Mor. 2000. Antimalarial activities of dermaseptin S4 derivatives. Antimicrob. Agents Chemother. 44:2442-2451.[Abstract/Free Full Text]
24 - Martin, M., J. Katz, S. N. Vogel, and S. M. Michalek. 2001. Differential induction of endotoxin tolerance by lipopolysaccharides derived from Porphyromonas gingivalis and Escherichia coli. J. Immunol. 167:5278-5285.[Abstract/Free Full Text]
25 - Marynka, K., S. Rotem, I. Portnaya, U. Cogan, and A. Mor. 2007. In vitro discriminative antipseudomonal properties resulting from acyl substitution of N-terminal sequence of dermaseptin S4 derivatives. Chem. Biol. 14:75-85.[CrossRef][Medline]
26 - Norskov-Lauritsen, N., and M. Kilian. 2006. Reclassification of Actinobacillus actinomycetemcomitans, Haemophilus aphrophilus, Haemophilus paraphrophilus and Haemophilus segnis as Aggregatibacter actinomycetemcomitans gen. nov., comb. nov., Aggregatibacter aphrophilus comb. nov. and Aggregatibacter segnis comb. nov., and emended description of Aggregatibacter aphrophilus to include V factor-dependent and V factor-independent isolates. Int. J. Syst. Evol. Microbiol. 56:2135-2146.[Abstract/Free Full Text]
27 - Ouhara, K., H. Komatsuzawa, S. Yamada, H. Shiba, T. Fujiwara, M. Ohara, K. Sayama, K. Hashimoto, H. Kurihara, and M. Sugai. 2005. Susceptibilities of periodontopathogenic and cariogenic bacteria to antibacterial peptides, β-defensins and LL37, produced by human epithelial cells. J. Antimicrob. Chemother. 55:888-896.[Abstract/Free Full Text]
28 - Papo, N., and Y. Shai. 2005. A molecular mechanism for lipopolysaccharide protection of gram-negative bacteria from antimicrobial peptides. J. Biol. Chem. 280:10378-10387.[Abstract/Free Full Text]
29 - Peschel, A., R. W. Jack, M. Otto, L. V. Collins, P. Staubitz, G. Nicholson, H. Kalbacher, W. F. Nieuwenhuizen, G. Jung, A. Tarkowski, K. P. van Kessel, and J. A. van Strijp. 2001. Staphylococcus aureus resistance to human defensins and evasion of neutrophil killing via the novel virulence factor MprF is based on modification of membrane lipids with L-lysine. J. Exp. Med. 193:1067-1076.[Abstract/Free Full Text]
30 - Peschel, A., M. Otto, R. W. Jack, H. Kalbacher, G. Jung, and F. Gotz. 1999. Inactivation of the dlt operon in Staphylococcus aureus confers sensitivity to defensins, protegrins, and other antimicrobial peptides. J. Biol. Chem. 274:8405-8410.[Abstract/Free Full Text]
31 - Pier, G. B. 2000. Role of the cystic fibrosis transmembrane conductance regulator in innate immunity to Pseudomonas aeruginosa infections. Proc. Natl. Acad. Sci. USA 97:8822-8828.[Abstract/Free Full Text]
32 - Piers, K. L., M. H. Brown, and R. E. Hancock. 1994. Improvement of outer membrane-permeabilizing and lipopolysaccharide-binding activities of an antimicrobial cationic peptide by C-terminal modification. Antimicrob. Agents Chemother. 38:2311-2316.[Abstract/Free Full Text]
33 - Pulendran, B., P. Kumar, C. W. Cutler, M. Mohamadzadeh, T. Van Dyke, and J. Banchereau. 2001. Lipopolysaccharides from distinct pathogens induce different classes of immune responses in vivo. J. Immunol. 167:5067-5076.[Abstract/Free Full Text]
34 - Pütsep, K., G. Carlsson, H. G. Boman, and M. Andersson. 2002. Deficiency of antibacterial peptides in patients with morbus Kostmann: an observation study. Lancet 360:1144-1149.[CrossRef][Medline]
35 - Ruissen, A. L., J. Groenink, P. Krijtenberg, E. Walgreen-Weterings, W. van 't Hof, E. C. Veerman, and A. V. Nieuw Amerongen. 2003. Internalisation and degradation of histatin 5 by Candida albicans. Biol. Chem. 384:183-190.[CrossRef][Medline]
36 - Satcher, D. S. 2000. Oral health in America: a report of the Surgeon General.
37 - Schmidtchen, A., I. M. Frick, E. Andersson, H. Tapper, and L. Bjorck. 2002. Proteinases of common pathogenic bacteria degrade and inactivate the antibacterial peptide LL-37. Mol. Microbiol. 46:157-168.[CrossRef][Medline]
38 - Scott, M. G., E. Dullaghan, N. Mookherjee, N. Glavas, M. Waldbrook, A. Thompson, A. Wang, K. Lee, S. Doria, P. Hamill, J. J. Yu, Y. Li, O. Donini, M. M. Guarna, B. B. Finlay, J. R. North, and R. E. Hancock. 2007. An anti-infective peptide that selectively modulates the innate immune response. Nat. Biotechnol. 25:465-472.[CrossRef][Medline]
39 - Shi, Y., D. B. Ratnayake, K. Okamoto, N. Abe, K. Yamamoto, and K. Nakayama. 1999. Genetic analyses of proteolysis, hemoglobin binding, and hemagglutination of Porphyromonas gingivalis. Construction of mutants with a combination of rgpA, rgpB, kgp, and hagA. J. Biol. Chem. 274:17955-17960.[Abstract/Free Full Text]
40 - Socransky, S. S., A. D. Haffajee, M. A. Cugini, C. Smith, and R. L. Kent, Jr. 1998. Microbial complexes in subgingival plaque. J. Clin. Periodontol. 25:134-144.[CrossRef][Medline]
41 - Sørensen, O. E., P. Follin, A. H. Johnsen, J. Calafat, G. S. Tjabringa, P. S. Hiemstra, and N. Borregaard. 2001. Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood 97:3951-3959.[Abstract/Free Full Text]
42 - Starner, T. D., W. E. Swords, M. A. Apicella, and P. B. McCray, Jr. 2002. Susceptibility of nontypeable Haemophilus influenzae to human β-defensins is influenced by lipooligosaccharide acylation. Infect. Immun. 70:5287-5289.[Abstract/Free Full Text]
43 - Yang, D., A. Biragyn, D. M. Hoover, J. Lubkowski, and J. J. Oppenheim. 2004. Multiple roles of antimicrobial defensins, cathelicidins, and eosinophil-derived neurotoxin in host defense. Annu. Rev. Immunol. 22:181-215.[CrossRef][Medline]
44 - Zasloff, M. 2002. Antimicrobial peptides of multicellular organisms. Nature 415:389-395.[CrossRef][Medline]
45 - Zasloff, M. 2002. Innate immunity, antimicrobial peptides, and protection of the oral cavity. Lancet 360:1116-1117.[CrossRef][Medline]
Antimicrobial Agents and Chemotherapy, February 2008, p. 638-642, Vol. 52, No. 2
0066-4804/08/$08.00+0 doi:10.1128/AAC.01271-07
Copyright © 2008, American Society for Microbiology. All Rights Reserved.
This article has been cited by other articles:
-
Gutner, M., Chaushu, S., Balter, D., Bachrach, G.
(2009). Saliva Enables the Antimicrobial Activity of LL-37 in the Presence of Proteases of Porphyromonas gingivalis. Infect. Immun.
77: 5558-5563
[Abstract]
[Full Text]
-
Wakabayashi, H., Yamauchi, K., Kobayashi, T., Yaeshima, T., Iwatsuki, K., Yoshie, H.
(2009). Inhibitory Effects of Lactoferrin on Growth and Biofilm Formation of Porphyromonas gingivalis and Prevotella intermedia. Antimicrob. Agents Chemother.
53: 3308-3316
[Abstract]
[Full Text]