Previous Article | Next Article ![]()
Antimicrobial Agents and Chemotherapy, June 2008, p. 2079-2088, Vol. 52, No. 6
0066-4804/08/$08.00+0 doi:10.1128/AAC.01415-07
Copyright © 2008, American Society for Microbiology. All Rights Reserved.

Department of Pathology, University of New Mexico Health Sciences Center, Albuquerque, New Mexico 87131
Received 1 November 2007/ Returned for modification 17 December 2007/ Accepted 28 March 2008
|
|
|---|
vβ3. Currently, there are no therapeutic agents available which specifically target SNV. To address this problem, we used phage display selection of cyclic nonapeptides to identify peptides that bound SNV and specifically prevented SNV infection in vitro. We synthesized cyclic nonapeptides based on peptide sequences of phage demonstrating the strongest inhibition of infection, and in all cases, the isolated peptides were less effective at blocking infection (9.0% to 27.6% inhibition) than were the same peptides presented by phage (74.0% to 82.6% inhibition). Since peptides presented by the phage were pentavalent, we determined whether the identified peptides would show greater inhibition if presented in a multivalent format. We used carboxyl linkages to conjugate selected cyclic peptides to multivalent nanoparticles and tested infection inhibition. Two of the peptides, CLVRNLAWC and CQATTARNC, showed inhibition that was improved over that of the free format when presented on nanoparticles at a 4:1 nanoparticle-to-virus ratio (9.0% to 32.5% and 27.6% to 37.6%, respectively), with CQATTARNC inhibition surpassing 50% when nanoparticles were used at a 20:1 ratio versus virus. These data illustrate that multivalent inhibitors may disrupt polyvalent protein-protein interactions, such as those utilized for viral infection of host cells, and may represent a useful therapeutic approach. |
|
|---|
We have chosen to develop peptide ligands capable of preventing infection by the Sin Nombre hantavirus (SNV). SNV is an NIAID category A pathogen responsible for hantavirus cardiopulmonary syndrome (HCPS), a syndrome for which there is currently no specific therapy and which has a case fatality rate approaching 40% (http://www.cdc.gov/ncidod/diseases/hanta/hps/index.htm). Hantaviruses are enveloped, negative-sense RNA viruses. The hantavirus envelope is studded with two transmembrane glycoproteins, Gn and Gc, that result from posttranslational cleavage of a single glycoprotein precursor (20). It has previously been demonstrated that hantavirus entry into human endothelial cells is mediated by the interaction of viral surface glycoproteins with integrin
vβ3 expressed on the host cell surface (10, 41). Both Gn and Gc may be involved in viral entry, with Gn thought to primarily mediate attachment and with Gc further driving membrane fusion (30, 48). The entry of pathogenic hantaviruses such as SNV into human cells in vitro can be prevented by neutralizing antibodies directed against the virus or against the integrin receptor
vβ3. In addition, we previously reported the use of phage display to identify cyclic peptides which bind
vβ3 and block SNV infection of Vero E6 cells (11, 26). Such peptides have therapeutic potential without the potential side effects of monoclonal antibody therapies conventionally used to block this type of interaction (2, 9).
One challenge in developing inhibitors of viral infection through receptor blockade is attempting to use a monovalent ligand to block a multivalent interaction. According to Mammen et al. (31), multi- or polyvalent interactions involve the simultaneous binding of multiple ligands on one biological surface or molecule to multiple receptors on an opposing surface or molecule. In the case of virus-host interactions, multivalent interactions are characterized by multiple copies of protein/glycoprotein on the virion surface interacting with multiple copies of the receptor on the host cell surface. Collectively, these multivalent interactions can be much stronger than predicted by the sum of the corresponding monovalent interactions (31). As a result, very high concentrations of monovalent inhibitors may be required to achieve significant levels of inhibition of viral infection in vitro. However, it may be possible to generate multivalent inhibitors or therapeutic agents effective at much lower doses, particularly in light of the fact that there have been numerous reports in which multivalent ligands have demonstrated enhanced target recognition, with binding increases of up to 108 over their monovalent counterparts (31-33).
One ready approach to the development of multivalent therapeutic agents is the ligation of monovalent inhibitors to nonimmunogenic microspheres or nanoparticles. In addition to acting as carriers of anticancer agents (reviewed previously by Sinha et al. in reference 46), nanoparticles have been used to deliver, among other things, antituberculosis drugs, antibiotics, and at least in the case of human immunodeficiency virus (HIV), antiviral agents (1, 3, 19, 29, 37, 50). Here, we sought to identify peptides that could bind directly to the SNV virion and inhibit infection. We began by using phage display to select cyclic nonapeptides capable of binding SNV. These peptides were tested for in vitro infection inhibition in the context of phage, as monovalent synthetic peptides, or in multivalent presentation on nanoparticles. Our results reemphasize the usefulness of phage display in identifying peptide inhibitors of protein-protein interactions and highlight the importance of inhibitor valency when multivalent biological processes are targeted.
|
|
|---|
Purification of polyclonal antibodies. We previously obtained sera from a rabbit immunized with the bovine serum albumin (BSA)-conjugated peptide LKIESSCNFDLHVPATTTQKYNQVDWTKKSS, which corresponds to residues 58 to 88 of Gn from SNV strain SN77734. We centrifuged the serum for 30 min at 10,000 x g and filtered the supernatant through sterile glass wool. A 1-ml HiTrap protein A HP column (GE Healthcare) was equilibrated with 20 mM sodium phosphate, pH 7.0, and sera (diluted 1:10 in the same buffer) were applied to the column at 0.5 ml/min. The column was washed with 10 ml of 20 mM sodium phosphate, pH 7.0, and IgG was eluted with 0.1 M citric acid, pH 4.5. The acid was immediately neutralized with 1 M Tris-HCl, pH 9.0. The protein concentration was determined spectrophotometrically. To reduce nonspecific binding, this polyclonal antibody, referred to as anti-Gn-BSA, was panned against BSA prior to each round of panning against SNV. We obtained anti-SNV antibodies from human convalescent plasma (HCP) in the same manner. To reduce nonspecific binding, this polyclonal antibody, referred to as HCP, was panned against normal human serum prior to each round of panning against SNV.
Preparation and purification of UV-inactivated SNV.
SNV was propagated and the titer was determined in Vero E6 cells under strict standard operating procedures using biosafety level 3 facilities and practices (CDC registration number C20041018-0267). For the preparation of UV-inactivated SNV, we placed 100 µl of virus stock (typically 1.5 x 106 to 2 x 106 FFU/ml) in each well of a 96-well plate and subjected the virus to UV irradiation at 254 nm (
5 mW/cm2). We established that virus inactivation was complete after 10 to 15 s of exposure by using a focus assay (4, 40).
Density gradient purification of SNV was performed as described previously (39). Briefly, we added 10 ml of UV-SNV to a 2-ml cushion of a 50% solution of OptiPrep (iodixanol, 5,5'-[(2-hydroxy-1-3 propanediyl)-bis(acetylamino)] bis [N,N'-bis (2,3-dihydroxypropyl-2,4,6-triiodo-1,3-benzenecarboxamide]) (Sigma-Aldrich) contained in a 14 by 89 mm polyallomer centrifuge tube (Beckman). This tube was placed in a TH641 swing bucket rotor (Sorvall) and centrifuged at 40,000 rpm for 3 h at 4°C. After centrifugation, we collected 4 ml of solution from the bottom of the tube and mixed it with 1 ml of a 50% OptiPrep solution. We added this to a 5-ml OptiSeal (Beckman) tube and centrifuged the tube at 65,000 rpm for 5 h at 4°C in an NVT90 rotor. We then collected 100-µl fractions from the bottom of the tube and determined the location and concentration of the virus proteins by quantitative Western blot analysis (data not shown). Viral particles appeared intact by electron microscopy (data not shown). Fractions that contained the viral particles were pooled and used in phage selection.
Isolation of SNV binding phage. Phage display was performed as described previously, with minor modifications, by using a cyclic nonapeptide phage library (26). For the first round of panning, 1 ml of UV-SNV in 0.1 M NaHCO3 (pH 8.6) buffer was coated onto 60- by 15-mm petri dishes (Nalge Nunc International, Naperville, IL) for a final concentration 0.3 µg of Gn/ml (2.41 x 1012 Gn/ml) and incubated overnight in a humidified chamber at 4°C. The following day, the plates were blocked for 1 h at room temperature with 5 mg/ml BSA in 0.1 M NaHCO3 (pH 8.6) buffer. The plates were washed six times with TBST (50 mM Tris-HCl, pH 7.5, 150 mM NaCl, 0.1% [vol/vol] Tween 20), and then the phage library was added to the plate at a phage concentration of 2 x 1011 in 1 ml TBST. The plate was gently rocked for 1 h at room temperature. Unbound phage were removed by washing 10 times with 1 ml of TBST. Bound phage were then eluted by adding 500 µl of 2.14 mg/ml HCP for 1 h with gentle rocking at room temperature. The eluate containing the bound phage was removed and saved. A second round of elution was performed using 500 µl of 1.5 mg/ml anti-Gn-BSA. Phage were amplified in Escherichia coli ER2738 bacteria and partially purified by polyethylene glycol precipitation. In subsequent rounds of panning, phage resulting from this first-round elution with HCP or anti-Gn-BSA were eluted exclusively with their corresponding antibodies. The binding, elution, and amplification steps were repeated using 2.41 x 1012 Gn/ml of UV-SNV for the second through fourth and second and third rounds of HCP and anti-Gn-BSA elutions, respectively, while 1.77 x 1012 Gn/ml was used for the fifth and sixth and fourth through sixth rounds, respectively.
Nucleotide sequencing and sequence analysis. After selection and amplification of the phage library on SNV, automated nucleotide sequencing derived the peptide sequence on the surface of the phage (DNA Research Services, Department of Pathology, University of New Mexico, Albuquerque, NM). Double-stranded DNA was prepared according to the manufacturer's specifications using the Qiagen QIAprep spin miniprep kit (Valencia, CA). DNA was amplified according to the manufacturers' specifications using the ABI Prism BigDye terminator 3.1 kit (Applied Biosystems, Foster City, CA) and the –96 gIII sequencing primer (New England Biolabs, Cambridge, MA). The reactions were purified using CentriSep spin columns (Princeton Separations, Adelphia, NJ). The samples were then dried, resuspended in formamide, and denatured. Sequencing was performed on a Hitachi 3100 gene analyzer (Applied Biosystems, Foster City, CA).
Sequence alignment of each peptide to human
vβ3 integrin was performed in a pairwise fashion. Alignments were performed using the Gap program, which is based on the algorithm of Needleman and Wunsch (36). We employed a Blosum62 scoring matrix, which has previously been shown to be effective for detecting protein sequence similarity based on evolutionary rates and analyzed amino acid pairs in blocks of aligned protein segments rather than individually as in earlier Dayhoff rule-based programs (13). The gap shift limit for
vβ3 was set at 12 and that for the peptide was set at 10. A quality score with a standard deviation was generated. The quality score for the alignment to any point is equal to the sum of the scoring matrix values of the matches in that alignment, less the gap-creation penalty times the number of gaps in that alignment, less the gap-extension penalty times the total length of all gaps in that alignment. We generated P values by performing 100 randomized alignments while preserving the amino acid composition (see the statistics of sequence similarity scores at the website for the National Center for Biotechnology Information, http://www.ncbi.nlm.nih.gov/BLAST/tutorial/Altschul-1.html). The unpaired Student's t test was used to generate a P value for each peptide alignment to SNV.
In-house peptide synthesis. For peptide synthesis, we used a ThuraMed automatic peptide synthesizer model 100 (ThuraMed/CreoSalus, Louisville, KY), along with amino acids at 5 equivalents of Fmoc-Cys(Trt)-Wang resin. Resin was swollen by three 30-min incubations in N-methylpyrrolidone. Fmoc deprotections were performed with 20% piperidine in DMF and washed alternately with DMF and methanol. Linear peptides were synthesized using standard Fmoc chemistry from the Fmoc-Cys(Trt)-Wang resin (0.6 mmol/g), with Cys as the final amino acid. Peptide was cyclized on resin according to the method of D. Limal et al. (28). Briefly, resin was suspended in cold 0.4 M Tl(tfa)3 and 4.5% anisole in DMF and mixed for 4 h at room temperature. The resin was washed three times each with dichloromethane and diethyl ether, then dried under vacuum for 18 h. For cleavage and deprotection of the peptides, we used 3 ml of TFA-triisopropylsilane-H2O (95/2.5/2.5) for 0.1 g of resin. The solution was mixed at room temperature for 4 h and then filtered. The filter was washed with two volumes of TFA, and this wash was added to the original filtrate, all of which was then concentrated to approximately 2 ml by using a rotary evaporator (BUCHI Labortechnik AG, Flawil, Switzerland). Crude peptide was precipitated by dropwise addition to 100 ml cold diethyl ether and precipitated overnight at –20°C. Precipitate solution was centrifuged at 10,000 rpm for 5 min at 4°C and washed six times with cold diethyl ether. Crude peptide was dried under vacuum for 18 h.
Crude peptide was purified using a binary gradient high-pressure liquid chromatography system (LabAlliance, State College, PA). Briefly, 20 mg of crude peptide was dissolved in 200 µl of TFA plus 400 µl of acetonitrile and then filtered through a 0.45-µm glass fiber filter. The volume was increased by the addition of 3.5 ml of 30% acetonitrile-0.3% TFA in H2O with the final volume adjusted to 5 ml with H2O. For peptide purification by high-pressure liquid chromatography, we used a 30- by 250-mm Hyperprep HS C18 column (Thermo Electron Corp., Bellefonte, PA) with a flow rate of 25 ml/min and a gradient from 10% acetonitrile, 0.1% TFA to 60% acetonitrile, 0.1% TFA over 80 min. The peptide peak was isolated, frozen, and then lyophilized.
Immunofluorescence assay. Twenty-four hours prior to beginning the immunofluorescence assay, duplicate wells of 104 Vero E6 cells/well were plated onto Lab-Tek 16-well chamber slides (Fisher Scientific, Pittsburgh, PA) by using minimal essential medium (MEM) (Gibco, Grand Island, NY) with 2.5% fetal bovine serum (FBS) and incubated at 37°C. SNV strain SN77734 (5) (2,000 to 3,000 FFU/ml) in MEM-2.5% FBS was mixed 1:1 with medium, phage at 2 x 109 phage/µl, 1 mM peptide, or 1 x 104 or 5 x 104 peptide-coated nanoparticles, and this virus mixture was incubated for 1 h at 37°C in a biosafety level 3 facility (Centers for Disease Control registration number C20041018-0267). Confluent Vero E6 cells were washed once with PBS, and 100 µl of virus mixture was added directly to the cells and incubated at 37°C for 1 h. When combination treatments were performed with anti-integrin peptides, these peptide or peptide-coated nanoparticles were incubated on the cells for 1 h at 37°C prior to addition of virus or anti-SNV peptide-virus mixture. In both cases, the virus mixture was subsequently removed by aspiration. The cells were washed twice with PBS, and MEM-2.5% FBS medium was added. After 24 to 36 h, the cells were fixed in 300 µl/well ice-cold methanol-acetone (50:50) and the slide was maintained at 4°C until staining. Cells were washed twice with PBS before staining and then overlaid with 100 µl of a 1:10,000 dilution of polyclonal rabbit anti-SNV recombinant N antibody (4) in PBS. After 1 h in a humidified chamber at 37°C, we added 50 µl of 1:500 FITC-conjugated anti-rabbit IgG in PBS and then washed the cells three times in PBS. For counterstaining, we used 200 µl of 1:105 Evans blue (wt/vol) for 3 to 5 min and then rinsed with water. After mounting, foci were counted by fluorescence microscopic examination using a Zeiss Axioskop fluorescence microscope. To determine the number of SNV foci added to each well, we used control wells that lacked any inhibitor. The percent inhibition was calculated as the number of infected cells relative to the untreated controls.
MVE calculations and statistical analysis. Multivalent enhancement ratio (MVE) calculations were based on the method of Montet et al. (35). Briefly, MVE is traditionally calculated as 50% of its maximum potential inhibitory concentration (IC50) or the 50% effective concentration (EC50) of the monovalent peptide divided by the IC50 or EC50 of the multivalent peptide-coated nanoparticle. In this report, we also used a modification of the MVE calculation, defined as the concentration of monovalent peptide divided by the concentration of the peptide on nanoparticles giving equivalent or higher percent inhibition relative to monovalent presentation. In the case of peptide-coated nanoparticles, MVE can be reported per mole of attached peptide or per mole of nanoparticle and is indicated where applied. Statistical analyses were performed on replicate samples by using an unpaired Student's t test. The mean ± standard error of the mean or ± the standard deviation is represented, and significance (the P value was <0.05 or P <0.0001, as indicated) is reported where appropriate.
|
|
|---|
|
View this table: [in a new window] |
TABLE 1. Inhibition with peptide-bearing phages
|
![]() View larger version (51K): [in a new window] |
FIG. 1. Inhibitory peptides identified by phage display show homology to the βA domain of integrin β3. (A) Pairwise alignment of peptide sequences from phage showing greater than 60% inhibition of SNV infection versus the cellular entry receptor integrin β3. Residues comprising the signal peptide, transmembrane region, and cytoplasmic tail of β3 were not included in the pairwise alignment (shown in italics). The PSI domain of integrin β3 is shown in orange, the hybrid domain is shown in gray, and the βA domain is underlined. β3 residues outlining the ReoPro binding site are shown in green. (B) Side and frontal view of integrin vβ3 (PDB 1U8C [49]). β3 is shown in surface representation (salmon), and v is shown as a light blue ribbon diagram. The βA domain of β3 is circled. Regions corresponding to the aligned peptides and the ReoPro binding site are colored as in panel A. (C) Enlargement of βA domain oriented as depicted on the right side of panel B. Graphics for panels B and C were prepared with Pymol (DeLano Scientific LLC, San Carlos, CA).
|
![]() View larger version (22K): [in a new window] |
FIG. 2. Dose-response curves showing the activites of peptide-bearing phage in blocking SNV infection. Along with HCP (diluted 1:400), controls included ReoPro at 40 µg/ml and a phage bearing the control peptide (CFSSARLSC) used at 109 phage/µl. Buffer controls include medium and the phosphate buffer used to dilute ReoPro. IC50 values for phage-bearing peptides CLVRNLAWC, CQTTNWNTC, and CSASTESLC were 1.0 x 106, 3.5 x 105, and 7 x 108, respectively, as determined by nonlinear regression analysis. Data points represent the mean of experiments performed in duplicate, and error bars show ± the standard errors of the mean. The dotted line indicates 50% inhibition.
|
![]() View larger version (31K): [in a new window] |
FIG. 3. Focus reduction assay demonstrating specificities of hantavirus inhibition by peptide-bearing phage. The five peptide-bearing phage that were the most potent inhibitors of SNV were tested in a parallel focus assay for their abilities to inhibit infection of Vero E6 cells by SNV, HTNV, and PHV. Virus (2,000 PFU) and 50 µl of 1 x 109 phage were added to each well. Controls include HCP (1:400) and ReoPro (40 µg/ml). The mean percent inhibition of infection is indicated, and the standard errors (error bars) of the means are shown. There were two to four samples tested for each condition.
|
![]() View larger version (21K): [in a new window] |
FIG. 4. Focus reduction assay comparing the abilities of monovalent peptides versus those of multivalent peptide-coated nanoparticles to block SNV infection of Vero E6 cells. Prior to being added to confluent monolayers of Vero E6 cells, SNV was treated with medium, 1 mM peptide, or peptide-coated nanoparticles (NP) at a nanoparticle:virus ratio of 4:1. ReoPro was added directly to Vero cells at a final concentration of 80 µg/ml, and HCP (1:400) and Gn-BSA antibody (1:40) were added directly to virus. The mean degrees of inhibition are indicated, and the standard errors (error bars) of the means are shown. The asterisk indicates statistical significance (P = 0.001). There were four samples for each condition.
|
Peptide-coated nanoparticles were further examined for their abilities to inhibit SNV entry in a dose-dependent manner at nanoparticle-to-virus ratios of 4:1, 8:1, and 20:1 (Fig. 5A). Nonlinear regression analysis of the SNV-specific, peptide-coated nanoparticles showed dose-dependent inhibition of SNV entry into Vero E6 cells. In fact, for two of the peptides presented on nanoparticles, CQTTNWNTC and CQATTARNC, increasing the peptide-nanoparticle:virus ratio from 4:1 to 20:1 lead to increases in inhibition from 21.7 to 41.1% and from 37.7 to 51.4%, respectively. In contrast, nanoparticles alone or nanoparticles coated with a random, non-SNV-specific peptide sequence (CLLRMKSAC), failed to significantly inhibit SNV infection even at a nanoparticle:virus ratio of 20:1. In all cases, increasing the nanoparticle:virus ratio beyond 20:1 (40:1 and greater) did not increase inhibition, nor did attempts to increase the amount of peptide coupled to the nanoparticles (data not shown). As the nanoparticles used here are approximately the same size as the SNV virions (approximately 100 nm in diameter), these data are not surprising, as it is reasonable to expect a limit to the number of peptide-coated nanoparticles that can simultaneously access a given virion and going beyond that saturation point would fail to increase potency. Likewise, the effective peptide density on a nanoparticle is likely to be limited by the mass of the glycoproteins on the virion surface, and beyond this critical peptide density, no additional glycoprotein binding sites are expected to be accessible.
![]() View larger version (32K): [in a new window] |
FIG. 5. Activity and specificity of peptide-coated nanoparticles in blocking SNV infection. (A) Dose-response curves showing the peptide-coated nanoparticles (CLVRNLAWC, CSASTESLC, CQTTNWNTC, CQATTARNC, and random) used at various concentrations and incubated with SNV for 1 h prior to being added to confluent monolayers of Vero E6 cells. Controls included ReoPro, medium only, and uncoated nanoparticles. ReoPro control was added directly to Vero cells at a final concentration of 80 µg/ml. After 24 to 36 h, monolayers were stained with polyclonal rabbit anti-SNV N (nucleocapsid) antibody, followed by FITC-conjugated anti-rabbit IgG antibody, and foci were counted. Each condition represents an N of 4 to 6. (B) Peptides and peptide-coated nanoparticle inhibitors of SNV were tested in a parallel focus assay for their abilities to inhibit infection of Vero E6 cells by SNV, HTNV, and PHV. Virus (2,000 PFU) and peptide (1 mM) or peptide-coated nanoparticles (at a nanoparticle-to-virus ratio of 4:1 or 20:1) were added to each well. Controls include medium, uncoated nanoparticles, and ReoPro (40 µg/ml). The mean degrees of inhibition are indicated, and the standard errors (error bars) of the means are shown. There were two samples tested for each condition.
|
We next wished to determine whether the peptides identified in this study bind the region of the SNV virion which mediates binding to integrin β3. To this end, we performed infection inhibition assays by using the anti-SNV peptides or peptide-coated nanoparticles in parallel or in combination with a peptide previously reported to block viral entry by binding to integrin β3, CPFVKTQLC, postulating that enhanced inhibition would be seen with combination treatment if the anti-SNV peptides blocked a region unique to that already blocked by the anti-integrin peptide (11, 26). As shown in Fig. 6, there was no significant difference in inhibition with the anti-β3 peptide CPFVKTQLC used as free peptide or as multivalent peptide-coated nanoparticles. There was some increase in inhibition with anti-SNV CLVRNLAWC-coated nanoparticles (at a nanoparticle-to-virus ratio of 20:1) used in combination with anti-β3 CPFVKTQLC-coated nanoparticles (at a nanoparticle-to-virus ratio of either 4:1 or 20:1), with specific increases from 56 to 64% and 54 to 69% inhibition, respectively. However, in an unpaired Student's t test, none of the combination treatments showed statistically significant improvements in inhibition above that of CPFVKTQLC treatment alone.
![]() View larger version (52K): [in a new window] |
FIG. 6. Focus reduction assay comparing the abilities of anti-SNV monovalent peptides and multivalent peptide-coated nanoparticles versus those of anti-integrin β3 peptides and coated nanoparticles to block SNV infection either alone or in combination treatments. In the case of the anti-SNV peptides, SNV was treated with medium, 1 mM peptide, or peptide-coated nanoparticles (NP), at a nanoparticle-to-virus ratio of 4:1 or 20:1, prior to being added to confluent monolayers of Vero E6 cells. In the case of the anti-integrin peptides, medium, 1 mM peptide, or peptide-coated nanoparticles, at a nanoparticle-to-virus ratio of 4:1 or 20:1, were added to the cells prior to addition of virus. ReoPro was added directly to Vero cells at a final concentration of 80 µg/ml. Mean degrees of inhibition are indicated, and the standard errors (error bars) of the means are shown. Each condition represents an N of 2. For the combination treatments shown in the last six groupings of the graph, the indicated anti-integrin treatment (shown below the bars) was paired with an anti-SNV treatment (shown above the bars).
|
|
|
|---|
Here we identified peptide antagonists of SNV infection through the selection of cyclic nonapeptide-bearing phage. Peptide selection by phage display technology allows the identification of active peptides from as many as 1012 different sequences at low cost and in a time-efficient manner. In the development of inhibitors of protein-protein interactions, peptides can be highly potent and specific, and the use of cyclic peptides, such as those reported here, yields additional advantages of increased protease resistance and longer half-lives as well as improved conformational stability over linear peptides (45). Furthermore, peptides can act as lead compounds by providing a structural basis for the identification of nonpeptide mimetics when oral availability and increased potency are required. Peptides have been identified that can inhibit a number of cellular targets, including angiotensin-converting enzyme 2 (17), melanoma inhibitor of apoptosis (8), vascular endothelial growth factor (14), and intracellular adhesion molecule 1 (44), to name but a few. Likewise, in addition to a large number of naturally occurring antimicrobial peptides, a number of additional peptides, either novel or based on cellular components, have been identified, including a 36-amino-acid peptide called enfuvirtide (Fuzeon; Roche) currently marketed to prevent HIV-1 infection of T cells (7, 27). The work reported here adds to the growing number of effective peptide inhibitors of agents of infectious diseases and emphasizes the utility of phage display in identifying such inhibitors.
Multivalent ligand presentation is often key to achieving effector or inhibitor activity in a biological system, and microspheres or nanoparticles can be important vehicles for achieving multivalency. For example, Montet et al. used 30-nm-diameter, aminated, cross-linked iron oxide nanoparticles coated with cyclo-RGD (cRGD) peptides to perform uptake and antiadhesion assays with integrin
vβ3-expressing endothelial cells and tumor cells (35) (20 RGD peptides per nanoparticle). Using the multivalent enhancement ratio (MVE) to quantify their results, described as the IC50 of free peptide/IC50 peptide displayed by nanoparticles, this group demonstrated an MVE of 38 for antiadhesion effects of cRGD-cross-linked iron oxide versus those of free cRGD (or an MVE of 760 calculated on a molar nanoparticle basis), along with an extension of the peptide blood half-life from 13 to 180 min (35). Youssef et al. reported a dramatic increase in therapeutic activity of nanoparticle-bound ampicillin over its free state in treating Listeria monocytogenes-infected athymic nude mice (50). This group, using ampicillin bound to polyisohexylcyanoacrylate nanoparticles approximately 187 nm in diameter (an ampicillin-to-polyisohexylcyanoacrylate ratio of 0.2:1), showed that 2.4 mg of nanoparticle-bound ampicillin had a greater therapeutic effect than 48 mg of free ampicillin (the equivalent of an MVE of 20). Bender et al. (3), using 475-nm-diameter polyhexylcyanoacrylate nanoparticles loaded with the HIV protease inhibitor saquinavir, demonstrated an IC50 of 0.39 nM while the value was 4.23 nM for free drug in HIV-infected human monocytes and macrophages in vitro, which is equivalent to an MVE of 10.8. Despite such impressive results, utilization of nanoparticles for surface delivery of antimicrobial agents has been underexploited. Two of the peptides reported here, CLVRNLAWC and CQATTARNC, showed improved inhibition over the free format when presented on nanoparticles at a 4:1 nanoparticle-to-virus ratio (9.0 to 32.5% and 27.6 to 37.6%, respectively), with CQATTARNC-mediated inhibition reaching more than 50% when nanoparticles were used at a 20:1 ratio relative to virus. Although we can only speculate as to why all the peptides did not show significant improvement with nanoparticle presentation, it may be a function of constraints upon the orientation required for binding the virion target. Since a carboxyl-amino linkage was utilized, all of the peptides should have some linkage to their N-terminal Cys residues. This possibility may have allowed the CLVRNLAWC and CQATTARNC peptides to achieve critical orientations required for inhibition, while simultaneously hindering critical orientations for the remaining peptides. Regardless, all the nanoparticle bound peptides showed comparable or enhanced levels of SNV inhibition at lower molar concentrations than the concentrations used for free peptide. Therefore, the results reported here for using nanoparticles as carriers of anti-SNV peptides highlight the importance of valency in antiviral agent presentation to maximize effectiveness and, in addition, demonstrate the broad potential of nanoparticles as carriers of therapeutic agents against SNV and other infectious diseases.
The two most important characteristics of nanoparticles used for the delivery of therapeutic agents are particle size and surface chemistry, both of which determine distribution and biological fate in vivo. The smaller size of nanoparticles over microparticles results in higher intracellular uptake and increased range of biological targets (reviewed previously by Mohanraj and Chen in reference 34). Surface hydrophobicity of nanoparticles also determines their in vivo fate. Upon intravenous administration, nanoparticles are able to pass through all capillaries (25) and can be rapidly removed from circulation. Also, blood proteins act as opsonins and adsorb to the surfaces of nanoparticles, facilitating phagocytic clearance by macrophages. This complication can be minimized by coating the surfaces of the nanoparticles with hydrophilic polymers, surfactants, or polyethylene glycol (34), which helps decrease opsonization and phagocytosis, thus increasing circulation time (21, 51). Therefore, opsonization minimization is important to the success of drug delivery via nanoparticles and to prolonged circulation time. Both of these factors must be optimized for in vivo use of therapeutic nanoparticle systems. Since the nanoparticles used in the work reported here contain a magnetic iron core, we will utilize nonmagnetic particles for in vivo toxicity and efficacy studies to optimize both the particle size and surface to achieve maximum inhibition with the anti-SNV cyclopeptides.
The approach used here to develop multivalent agents, through the ligation of monovalent inhibitors to microspheres or nanoparticles, is but one of myriad strategies for achieving multivalency. For example, a variety of dendrimers have been utilized for multivalent presentation of peptides as vaccines or inhibitors, including N-acetylneuraminic-acid-substituted dendrimers effective against Sendai virus and certain influenza strains (42) as well as lipopeptide dendrimers used to present disulfide-cyclized peptide inhibitors of foot-and-mouth disease (6, 43). Liposomes have been used to incorporate sialic acid gangliosides to prevent hemagglutination by influenza (22, 47) and synthetic multivalent carbohydrate ligands have been used to produce potent neutralizers of Shiga-like toxins (23). Although these are but a few of the many approaches to preparing multivalent ligands, we found the use of nanoparticles as described here to have some distinct advantages for use with peptide ligands. First, nanoparticles with surface chemistries for carboxyl or amino-peptide linkage are readily available commercially and procedures for the ligation of proteins or peptides to these surfaces are rapid and well documented. Furthermore, nanoparticles are available in a variety of sizes and surface coatings, both of which affect cellular uptake and clearance and which in turn allow for the optimization of both the peptide inhibitor as well as the carrier (21, 24, 34). In addition, the previously described clinical use of nanoparticle encapsulated delivery systems for breast cancer and HIV-1 therapeutic agents (29, 38) warrants the development of additional in vivo uses of nanoparticles for the delivery of therapeutic agents, such as those described here for in vitro prevention of hantavirus infection and disease.
In this investigation, we did not exhaustively examine the means of optimizing valency and presentation of the peptide inhibitors we identified for SNV. Additional work will be required to optimize both the inhibitory peptides and nanoparticle delivery system reported here before beginning in vivo efficacy and toxicity studies. However, it is of note that some of the combination treatments shown in Fig. 6 gave higher average inhibition levels than did the control Fab, ReoPro. In addition, although we can only speculate about this in the absence of direct binding experiments, the lack of additive inhibition when combining peptides selected to target the SNV virion with those selected to target integrin β3 suggests that anti-SNV peptides interact with a region of the SNV virion that interacts with integrin β3. As it is reasonable to expect that the panel of HCP-eluted peptides may contain some that interfere with fusion and others that block binding, we are continuing to screen peptides from Table 1 to identify those that may be useful for combination treatments to block binding and fusion. Meanwhile, our results emphasize the usefulness of phage display in identifying novel peptide inhibitors of protein-protein interactions. In addition, the dramatic increase in effectiveness of anti-SNV peptides presented on nanoparticles highlights the importance of inhibitor valency when multivalent biological processes are targeted. We propose that anti-SNV peptide-coated nanoparticles can be further optimized to be potent inhibitors of SNV infection and HCPS.
This work was supported by the NCMR grant "Integrated Network of Ligand-Based Autonomous Bioagent Detectors" and by Public Health Service grants U01 AI 56618 (B.H.), U01 AI054779 (B.H.), and R56 AI034448 (R.S.L.). P.R.H. was supported by National Institute of Allergy and Infectious Disease grant T32 AI07538-06 (to B.H.).
Published ahead of print on 7 April 2008. ![]()
|
|
|---|
This article has been cited by other articles:
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Copyright © 2010 by the American Society for Microbiology. For an alternate route to Journals.ASM.org, visit: http://intl-journals.asm.org | More Info»