This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Björstad, A.
Right arrow Articles by Bylund, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Björstad, A.
Right arrow Articles by Bylund, J.

 Previous Article  |  Next Article 

Antimicrobial Agents and Chemotherapy, March 2009, p. 1027-1038, Vol. 53, No. 3
0066-4804/09/$08.00+0     doi:10.1128/AAC.01310-08
Copyright © 2009, American Society for Microbiology. All Rights Reserved.

The Host Defense Peptide LL-37 Selectively Permeabilizes Apoptotic Leukocytes{triangledown}

Åse Björstad,1* Galia Askarieh,2 Kelly L. Brown,1 Karin Christenson,1 Huamei Forsman,1 Karin Önnheim,1 Hsin-Ni Li,3 Susann Teneberg,4 Olaf Maier,5 Dick Hoekstra,5 Claes Dahlgren,1 Donald J. Davidson,3 and Johan Bylund1

Department of Rheumatology and Inflammation Research, Sahlgrenska Academy at University of Gothenburg, Gothenburg, Sweden,1 Department of Infectious Diseases, Sahlgrenska Academy at University of Gothenburg, Gothenburg, Sweden,2 MRC/University of Edinburgh Centre for Inflammation Research, Queen's Medical Research Institute, Edinburgh, Scotland,3 Department of Medical Biochemistry and Cell Biology, Institute of Biomedicine, Sahlgrenska Academy at University of Gothenburg, Gothenburg, Sweden,4 Department of Cell Biology, Membrane Cell Biology Section, University Medical Center Groningen, University of Groningen, Groningen, The Netherlands5

Received 30 September 2008/ Returned for modification 16 October 2008/ Accepted 2 December 2008


arrow
ABSTRACT
 
LL-37 is a cationic host defense peptide that is highly expressed during acute inflammation and that kills bacteria by poorly defined mechanisms, resulting in permeabilization of microbial membranes. High concentrations of LL-37 have also been reported to have cytotoxic effects against eukaryotic cells, but the peptide is clearly capable of differentiating between membranes with different compositions (eukaryotic versus bacterial membranes). Eukaryotic cells such as leukocytes change their membrane composition during apoptotic cell death, when they are turned into nonfunctional but structurally intact entities. We tested whether LL-37 exerted specific activity on apoptotic cells and found that the peptide selectively permeabilized the membranes of apoptotic human leukocytes, leaving viable cells unaffected. This activity was seemingly analogous to the direct microbicidal effect of LL-37, in that it was rapid, independent of known surface receptors and/or active cell signaling, and inhibitable by serum components such as high-density lipoprotein. A similar selective permeabilization of apoptotic cells was recorded for both NK cells and neutrophils. In the latter cell type, LL-37 permeabilized both the plasma and granule membranes, resulting in the release of both lactate dehydrogenase and myeloperoxidase. Apoptosis is a way for inflammatory cells to die silently and minimize collateral tissue damage by retaining tissue-damaging and proinflammatory substances within intact membranes. Permeabilization of apoptotic leukocytes by LL-37, accompanied by the leakage of cytoplasmic as well as intragranular molecules, may thus shift the balance between pro- and anti-inflammatory signals and in this way be of importance for the termination of acute inflammation.


arrow
INTRODUCTION
 
The cathelicidins form a large family of microbicidal, cationic host defense peptides found in all mammalian species examined so far, including humans, cows, pigs, rabbits, sheep, mice, monkeys, and horses (60). Only one human cathelicidin, human cationic antimicrobial protein 18 (hCAP-18; unprocessed form), or LL-37 (the predominant, mature antibacterial form), has been isolated. LL-37 is mainly expressed by neutrophils and epithelial cells during acute inflammation. LL-37 is stored as a propeptide in the specific granules of neutrophils. Upon neutrophil activation, the proform is cleaved enzymatically by proteinase 3 to the active form during degranulation toward the extracellular compartment (49). The concentration of LL-37 can be severely increased at sites of inflammation, and levels up to about 15 to 25 µg/ml have been reported in bronchoalveolar lavage fluid from infants with pulmonary infections as well as from cystic fibrosis patients (14, 45); even higher levels (over 1 mg/ml) has been reported from psoriatic skin lesions (40).

LL-37 was originally identified as a cationic microbicidal peptide due to its ability to specifically permeabilize prokaryotic membranes (1, 16, 31); it possesses direct microbicidal activity against bacteria, fungi, and enveloped viruses (5, 33). Very high concentrations of LL-37 have also been reported to have cytotoxic effects against eukaryotic cells in vitro (28). The microbial killing mechanism is dependent on the membrane-active properties of the peptide, which has the ability to interact with both the inner and the outer membranes of gram-negative bacteria (22). The mode of action for the direct microbicidal activity of host defense peptides has not been determined conclusively, but the leading hypothesis is that these peptides are membrane active and have the ability to break the integrity of bacterial cell membranes more or less selectively over eukaryotic membranes (47). Bacterial membranes are composed of phospholipids different from those of eukaryotic cell membranes, with the bacterial membranes being more negatively charged than their eukaryote counterparts. The presence of surface molecules other than phospholipids, e.g., lipopolysaccharide (LPS; an outer membrane component of gram-negative bacteria), is also of importance to the overall negative charge of bacterial membranes. This negative charge is, in part, believed to be a determinant for the interaction with cationic peptides and gives the peptides selectivity for the microbial membranes (37).

Lately, LL-37 has been shown to have immunomodulatory properties, in addition to its microbicidal potential (10), and is also capable of activating various immune cells; thus, it possesses a functional dualism that is also displayed by certain other cationic peptides (7, 13, 51, 58). Among the numerous immunomodulatory actions displayed by LL-37, chemoattraction and the induction of chemokine release from leukocytes, the stimulation of angiogenesis, and the binding and neutralization of bacterial LPS can be found (9). LL-37 has been shown to be highly upregulated under inflammatory conditions, particularly those involving the skin, e.g., psoriasis (20, 40). During inflammation, it is of vital importance that the activities of the cells involved are tightly regulated. Many inflammatory leukocytes, especially neutrophils, are packed with a variety of cytotoxic substances aimed at microbial killing, and if these substances reach the extracellular environment in an uncontrolled fashion, the risk of tissue destruction and sustained inflammation are increased (25, 56). One important means of ridding the system from potentially harmful intracellular constituents is by apoptosis of the inflammatory cells, followed by phagocytic clearance of the corpse by viable phagocytes (34, 44). Apoptosis is often called the physiological, programmed form of cell death, characterized by the lack of proinflammatory actions and the minimization of damage to surrounding cells and tissue. Apoptotic cells are nonfunctional but, importantly, carry an intact cell membrane that prevents the uncontrolled leakage of intracellular molecules (25). Despite the integrity of the apoptotic cell membrane, its surface-exposed molecule composition differs substantially from that of the membranes of viable cells. One prominent example of surface changes relates to phospholipids. In viable cells, an uneven distribution of phospholipids between the two leaflets of the double-sided membrane is maintained by an energy-dependent process that keeps the negatively charged phosphatidylserine (PS) on the inside. In a nonfunctional apoptotic cell, the PS distribution is leveled out over time, with the PS also being on the outer leaflet as a result (35), making the membrane of apoptotic cells more negatively charged and, in this way, more like the membrane of bacteria. The surface-located PS is also an important "eat-me" flag that ensures phagocytic clearance of the apoptotic cell (18). Annexin V is a Ca2+-dependent, cell-impermeant protein with a high affinity for PS. When it is conjugated to a fluorochrome, it is widely used for the detection and quantification of apoptosis by flow cytometry.

Given the ability of LL-37 to distinguish between prokaryotic and eukaryotic membranes and the fact that the composition of eukaryotic membranes changes when a cell becomes apoptotic, we investigated whether the peptide could distinguish between viable and apoptotic leukocytes. Using primary human neutrophils, a cell type that has a short half-life in vivo and that rapidly enters apoptosis in culture, we found that LL-37 selectively permeabilized the membranes of apoptotic cells under serum-free conditions, leaving viable cells unaffected in this respect. A specificity similar to that for apoptotic cells was also found for NK cells, another inflammatory leukocyte, which was rendered apoptotic by treatment with hydrogen peroxide. The selective permeabilization of apoptotic neutrophils was very rapid and seemingly independent of known LL-37 surface receptors and/or active cell signaling. Peptide-induced permeabilization in effect shifted apoptotic cells into a necrotic phenotype, whereby intracellular constituents were released into the extracellular milieu; leakiness was effectively counteracted by the presence of human serum or high-density lipoprotein (HDL) in a similar manner, as microbial killing by LL-37 was blocked by these substances. The mere surface exposure of the negatively charged PS, a consequence of apoptosis, was not responsible for the selective permeabilization of apoptotic cells. We concluded that LL-37 possesses selective permeabilizing activity on apoptotic leukocytes in a manner seemingly analogous to its activity against bacterial membranes. In pathological settings with high levels of cathelicidin expression in the absence of serum constituents (such as psoriatic lesions), the permeabilization of apoptotic leukocytes by LL-37 could be of importance in determining the eventual outcome of acute inflammation.


arrow
MATERIALS AND METHODS
 
Reagents. LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES) was synthesized by N-(9-fluorenyl)methoxycarbonyl chemistry at the Nucleic Acid/Protein Service Unit at the University of British Columbia (Vancouver, British Columbia, Canada). Scrambled LL-37 (sLL-37; RSLEGTDRFPFVRLKNSRKLEFKDIKGIKREQFVKIL) was purchased from CSS-Albachem Ltd. (East Lothian, United Kingdom). WKYMVM was from Alta Bioscience (Birmingham, United Kingdom), and WRW4 was from Genscript Corp. (Scotch Plains, NJ). Hp(2-20) was synthesized and purified by high-pressure liquid chromatography (Innovagen, Lund, Sweden). Ficoll-Paque was from Pharmacia (Uppsala, Sweden), and Ficoll-Hypaque was from Nycomed (Oslo, Norway). Dextran was purchased from Amersham Biosciences (Uppsala, Sweden). The A-6013 agarose used for the casting of all plates for the inhibition zone assays was from Sigma Chemical Co. (St. Louis, MO), as were oxidized ATP (oxATP), HDL, cytochalasin B, lidocaine, colchicine, and calcein. The antibody {alpha}-CD95 was from Nordic BioSite (Täby, Sweden). Annexin V-fluorescein isothiocyanate (FITC), annexin V-allophycocyanin (APC), 7-amino-actinomycin D (7-AAD), and the BD IMag NK cell isolation kit were supplied by BD Biosciences (San Jose, CA). RPMI 1640 medium was from PAA Laboratories (Pasching, Austria). The lipids used for liposome preparation (1,2-dipalmitoyl-sn-glycero-3-phosphatidylethanolamine [DPPE], 1,2-dipalmitoyl-sn-glycero-3-phosphatidylcholine [DPPC], 1,2-dipalmitoyl-sn-glycero-3-phosphatidyl-rac-glycerol, sodium salt [DPPG], dioleoyl-sn-glycero-3-phosphatidylserine [DOPS], and cholesterol) were purchased from Larodan (Malmö, Sweden).

Isolation and culture of human cells. Human neutrophils were isolated by a standard technique (11, 12) from buffy coats obtained from the blood of healthy donors at the Sahlgrenska Hospital, Gothenburg, Sweden. In short, dextran sedimentation was performed at 1 x g, followed by hypotonic lysis of the remaining erythrocytes and centrifugation in a Ficoll-Paque gradient. Thereafter, the neutrophils were washed twice and resuspended in RPMI 1640 medium supplemented with 10% fetal calf serum to a density of 5 x 106 cells/ml. Cells (500 µl) were added to polypropylene tubes and incubated at 37°C in 5% CO2 for 20 h for the induction of spontaneous apoptosis. For increased apoptosis, azide-free {alpha}-CD95 monoclonal antibody (10 µg/ml) was coincubated with the cells, which resulted in approximately 20% viable neutrophils and 80% apoptotic neutrophils.

For the isolation of NK cells, peripheral venous blood was incubated with Iscove's modified Dulbecco's medium, dextran, and acid citrate dextrose for 15 min at room temperature. The supernatant was centrifuged through a Ficoll-Hypaque (Lymphoprep) density gradient, and the mononuclear cells at the interface were collected and further processed by countercurrent centrifugal elutriation (57). In short, this technique allows cell separation on the basis of the cell sedimentation rate in a spinning rotor at 2,150 rpm balanced by a counterdirected flow through a chamber. By varying the flow rate, different cell fractions were separated on the basis of their sizes. The NK-cell-enriched lymphocyte fractions were collected at flow rates of between 14 and 15 ml/min, and the cells were then further isolated through negative selection with magnetic beads (BD IMag NK cell isolation kit), according to the instructions provided by the manufacturer. Finally, the isolated NK cells were incubated overnight in Iscove's modified Dulbecco's medium supplemented with 10% normal human serum at 37°C in 5% CO2. For the induction of the early apoptotic characteristics in the NK cells, 100,000 to 200,000 cells incubated overnight were exposed to 200 µM H2O2 for 6 h at 37°C in 5% CO2 (23, 24, 53).

Evaluation of apoptosis. The neutrophils that had been incubated overnight, as described above, were washed and resuspended in annexin V binding buffer (AVBB; 1 mM HEPES, 14 mM NaCl, 0.25 mM CaCl2; pH 7.4) to 6.25 x 106 cells/ml. Samples (70 µl) were stained with 5 µl annexin V-FITC for 5 min at ambient temperature, whereupon 7-AAD was added, and the staining was continued for 10 min before the addition of AVBB to give a final volume of 500 µl. In some experiments, annexin V-FITC was exchanged for {alpha}-CD16-FITC: 100-µl samples were stained with 10 µl antibody for 10 min at 0°C, whereupon staining with 7-AAD was performed as described above. Peptides diluted in water were added 5 min prior to analysis, if not indicated otherwise. HDL (650 µg/ml), bovine serum albumin (0.5%; wt/vol), or 10% salt mimicking serum salt (11.3 mM NaCl, 2.4 mM NaHCO3, 0.06 mM MgCl2, 0.13 mM CaCl2, 0.39 mM KCl) (28) was added to the indicated samples before the addition of peptide. Samples were analyzed by fluorescent-activated cell sorter analysis before and after the addition of peptides. For samples treated with the formyl peptide receptor-like 1 (FPRL1) antagonist, WRW4 (5 µM) was added 5 min (at 37°C) prior to the addition of peptide. The same procedure was used for the P2X7 inhibitor oxATP (900 µM), but by the procedure with oxATP, the samples were preincubated with the inhibitor for 30 min. The concentrations and incubation times for the inhibitors have previously been shown to specifically block Ca2+ flux induced through FPRL1 and P2X7, respectively (15). The inhibitors of membrane repair cytochalasin B (10 µg/ml), colchicine (10 µM), or lidocaine (5 mM) were coincubated with the cells overnight and were added to all buffers used for the subsequent experiments, as indicated.

The H2O2-treated NK cells were washed and resuspended in AVBB. Each sample was stained at ambient temperature with 5 µl annexin V-FITC for 5 min, followed by staining with 5 µl 7-AAD, for a final volume of 100 µl, for another 10 min. The samples were thereafter diluted to 300 µl with AVBB before analysis. Flow cytometry was performed before and 5 min after the addition of LL-37 (5 µg/ml was used for NK cells, as these cells are more susceptible than neutrophils to the cytotoxic action of LL-37).

Determination of direct microbicidal activity. Escherichia coli strain MG1655 was grown overnight in Luria-Bertani (LB) broth (3) at 37°C on a rotary shaker. A modified inhibition zone assay was used for the detection of direct microbicidal activity (21, 26, 27). In short, standard LB agar (LB broth supplemented with 1% [wt/vol] agarose) containing bacteria (approximately 5 x 105 CFU in logarithmic growth phase per milliliter agar) was poured into petri dishes (diameter, 92 mm). Wells (diameter, 3 mm; depth, 1 mm) were punched in the agar, and peptide preparations (3 µl) diluted in distilled water were added to the wells, whereupon the plates were incubated at ambient temperature for 45 min and then at 37°C overnight. The peptide was used in the assays at amounts ranging from 1.88 µg/well to 7.5 µg/well. Inhibition zones were calculated as the diameter of the clear zones, free of visible bacteria, surrounding the wells. HDL (650 µg/ml) was added to the agar plates before the plates were cast.

Liposome preparation. Lipids (DPPE, DPPC, DPPG, and cholesterol) were dissolved in chloroform-methanol (1:1) to a concentration of 20 mg/ml. DOPS was dissolved in chloroform to 25 mg/ml. The lipid mixtures (final concentration of total lipids, 2.5 mM) were dissolved in chloroform-methanol (1:1) and dried under reduced nitrogen pressure at 45°C, with subsequent drying under vacuum for 1 h. Liposomes containing the following were prepared: DPPE-DPPC-cholesterol (1:1:1; lipids typically found in eukaryotic membranes), DPPE-DPPG (7:3; phospholipids typically found in bacterial membranes), and DPPE-DPPC-cholesterol-DOPS (3:3:3:1; lipids typically found in eukaryotic plasma membranes with 10% PS). During the subsequent preparation steps, the liposomes were kept at 50°C at all times to avoid solidification of the dipalmitoyl lipids. The dried lipid film was dissolved in 1 ml Tris buffer (150 mM NaCl, 10 mM Tris, 1 mM EDTA; pH 7.4) containing self-quenching concentrations of calcein (80 mM), and the mixture was vigorously vortexed and then given a short sonication. Large unilamellar vesicles were obtained by passing the suspension 20 times through 400-, 200-, and 100-nm-pore-size polycarbonate filters (Eschborn, Germany) on a handheld extruder. Extraliposomal calcein was removed by filtration through Sephadex G-50 resin. The release of calcein to the extraliposomal medium upon peptide addition was monitored continuously by measuring the fluorescence intensity on a Perkin-Elmer LS55 fluorescence spectrometer (excitation {lambda}, 494 nm; emission {lambda}, 513 nm). The maximum fluorescence intensity, which corresponded to 100% leakage, was determined by adding Triton X-100 (0.1%) to the liposomes.

Intracellular Ca2+ measurements. Intracellular Ca2+ was measured by a previously described method (42). In short, neutrophils incubated overnight for the induction of apoptosis were resuspended in cell loading medium (1% fetal calf serum in Krebs-Ringer phosphate buffer containing glucose [10 mM glucose, 1 mM Ca2+, 1.5 mM Mg2+; pH 7.3]) and loaded with Fluo-3 (4 mg/ml) and Fura-Red (10 mg/ml) reagents at 37°C for 30 min. The cells were washed twice, resuspended in AVBB to a final concentration of 6 x 106/ml, and stained with annexin V-APC at ambient temperature for 15 min. The samples were diluted to 8.75 x 105 cells/ml, and 0.5 ml was prewarmed at 37°C for 5 min. The level of intracellular Ca2+ accumulation in individual cells upon the addition of WKYMVM (10–7 M) was assessed by flow cytometry over 5 min. The fluorescence emissions of the Fluo-3 and Fura-Red reagents were measured in the FL-1 and the FL-3 channels, respectively. The data were analyzed by using the kinetics mode of FlowJo software (version 5.7.1; FlowJo, LLC, Ashland, OR), and the relative intracellular Ca2+ concentration was presented as the ratio between the mean fluorescence intensity of the Fluo-3 reagent and that of the Fura-Red reagent over time. The analysis of Ca2+ accumulation was performed after gating of viable and apoptotic cells by the use of annexin V-APC staining.

To establish that the apoptotic neutrophils were properly labeled with the Fluo-3 and Fura-Red reagents, ionomycin (500 nM) was included as a positive control stimulus. This ionophore forms pores in the plasma membrane, giving rise to an artificial, signaling-independent rise in the intracellular calcium concentration. Addition of ionomycin resulted in an increase in the intracellular calcium concentration in the apoptotic cells as well as the viable cells (data not shown).

Measurements of LDH and MPO release from LL-37-treated neutrophils. Neutrophils (5 x 106/ml) were incubated overnight in 5% CO2 at 37°C, and {alpha}-CD95 (10 µg/ml) was included for the induction of apoptosis or was not included. The cells were washed and diluted to 1 x 106/ml before treatment with LL-37 (50 µg/ml) for 10 min. All samples were divided in two, and one portion of each sample was lysed with Triton X-100 (1%) for 1 min, after which the cell debris was removed by centrifugation. The amount of the cytosolic enzyme lactate dehydrogenase (LDH) released was measured with a cytotoxicity detection kit from Roche Diagnostics GmbH (Mannheim, Germany), according to the manufacturer's directions. The myeloperoxidase (MPO) content in the neutrophils was measured by determination of the amount of enzyme activity by mixing 50 µl of the cell supernatants described above with 100 µl peroxidase substrate (1,2-phenylenediamine dihydrochloride [Dako Denmark A/S]) in a 96-well plate and incubation of the plate overnight at room temperature. The absorbance at 492 nm was then measured.

Statistical analysis. The results are expressed as means ± standard deviations (SDs). Unpaired and paired t tests were used for statistical analysis, and P values are two tailed with 95% confidence intervals. For comparisons of multiple data sets, one-way analysis of variance with Bonferroni's multiple-comparison tests was performed. The data were analyzed with GraphPad Prism software (version 4.02; GraphPad Software, San Diego, CA).


arrow
RESULTS
 
Direct microbicidal action of LL-37 and discrimination between membranes of different compositions. LL-37 is a host defense peptide with dual actions that both works directly by permeabilizing microbial membranes and has receptor-dependent, immunomodulatory actions on leukocytes as a means of protecting against infections. The direct microbicidal effects of LL-37 and the sLL-37 control peptide against E. coli were assessed in inhibition zone assays; LL-37 induced a clear zone around the well that was free of visible bacteria, while sLL-37 had no direct microbicidal effect (Fig. 1A). The lethal concentration was calculated to 6.3 µg/ml for E. coli (strain MG1655) under the specific medium conditions used in the assay. The lethal concentration was determined from the diameter of the inhibition zone by a previously described method (26) and was defined as the lowest concentration that just inhibited colony formation in the thin agar plates. Under the serum-free conditions used, LL-37 (100 µg/ml) had no effect on the integrity of the cell membranes of freshly prepared neutrophils, as shown by a lack of 7-AAD staining (Fig. 1B). This dye is incapable of passing intact cell membranes and therefore functions as a useful marker of membrane integrity (46). These experiments show that LL-37 can be directly microbicidal in the 5-µg/ml range (as determined by calculation of the lethal concentration from the results obtained from the inhibition zone assays), whereas concentrations up to 100 µg/ml were not cytotoxic for neutrophils under serum-free conditions.


Figure 1
View larger version (32K):
[in this window]
[in a new window]

 
FIG. 1. LL-37 can distinguish between membranes with different compositions. (A) The direct microbicidal activity of LL-37 (1.88, 3.75, and 7.5 µg/well) against E. coli was determined in an inhibition zone assay. LL-37 gave rise to clear, bacteria-free zones around the wells (upper panel), while sLL-37 (1.88, 3.75, and 7.5 µg/well) was inactive (lower panel). (B) Freshly separated neutrophils were not sensitive to the direct microbicidal, lytic action of LL-37 (100 µg/ml), as shown by the lack of 7-AAD fluorescence intensity plotted against the forward scatter. 7-AAD is a nucleic acid stain used for the detection of the loss of membrane integrity in cells. The results of one experiment with the percentage of cells in each region are shown. (C) LL-37 (5 ng/ml) readily permeabilized bacterial membrane-like liposomes (gray line) composed of PE-PG (7:3), while the eukaryotic membrane-like liposomes (black line), composed of PE-PC-cholesterol (1:1:1), were more resistant to the permeabilizing effect of LL-37. The percentage of total calcein released, as assessed by the addition of Triton X-100, is plotted against time. The means ± SDs (n = 3) obtained at 0, 50, 100, 150, and 200 s are shown. The amounts of calcein released at 100, 150, and 200 s were compared; and significant differences between the amounts released were was established (P < 0.01 at each point, as indicated [**]; n = 3). The arrow indicates the time of addition of peptide.

To further characterize the ability of LL-37 to discriminate between bacterial and eukaryotic membranes, we tested the effect of LL-37 on liposomes containing the lipids typically found in bacterial as well as in eukaryotic membranes in a calcein release assay. Bacterial membranes are slightly more negatively charged than eukaryotic membranes, and liposomes containing large amounts of neutral PE and the negatively charged phosphatidylglycerol (PG) were synthesized. For the eukaryotic membrane-like liposomes, cholesterol was incorporated together with the two neutral phospholipids PE and PC. As expected, LL-37 readily permeabilized the bacterial membrane-like liposomes (Fig. 1C). The eukaryotic membrane-like liposomes were permeabilized to a limited extent (approximately 15%), but they were obviously much more resistant than the bacterial membrane-like liposomes to the lytic action of LL-37. Taken together, these data show that LL-37 is clearly capable of differentiating between membranes with different compositions.

Selective permeabilization of apoptotic neutrophils by LL-37. LL-37 had no cytotoxic effect on freshly prepared human neutrophils (Fig. 1B). In order to study the effect of LL-37 on viable and apoptotic membranes of primary leukocytes, we employed human neutrophils, which gradually enter spontaneous apoptosis during in vitro culture. In this set of experiments, neutrophils incubated overnight spontaneously entered apoptosis, leaving a mixed population of cells with 66% viable cells (annexin V negative, 7-AAD negative) and 31% apoptotic cells (annexin V positive, 7-AAD negative), as assessed by flow cytometry (Fig. 2A, left panel). By use of this standardized protocol, very few cells (less than 3%) displayed a necrotic phenotype with permeable membranes, as indicated by the lack of 7-AAD-positive events. The use of this mixed culture enabled us to investigate viable and apoptotic cells simultaneously, and addition of LL-37 (50 µg/ml, 5 min of incubation) to the mixed population selectively permeabilized the apoptotic cells that acquired the 7-AAD stain under serum-free conditions (Fig. 2A, middle panel, upper right quadrant). The membranes of annexin V-negative cells were still intact (7-AAD negative) after the addition of peptide (Fig. 2A; middle panel, lower left quadrant). sLL-37 (50 µg/ml, 5 min of incubation) did not permeabilize any cell type (Fig. 2A, right panel), indicating that the cationic nature of LL-37 is not sufficient to permeabilize apoptotic neutrophils. sLL-37 at a concentration of 500 µg/ml was also ineffective (data not shown).


Figure 2
View larger version (37K):
[in this window]
[in a new window]

 
FIG. 2. Selective permeabilization of apoptotic neutrophils by LL-37. (A) Neutrophils incubated for 20 h spontaneously entered apoptosis, resulting in 66% viable cells and 31% apoptotic cells, as assessed by annexin V and 7-AAD staining and visualized by flow cytometry (left panel). When LL-37 (50 µg/ml) was added to these cells, all apoptotic (annexin V-positive) cells were permeabilized (7-AAD positive), while the viable (annexin V-negative) population was unaffected (middle panel) 5 min after addition of the peptide. sLL-37 (50 µg/ml) was inactive when it was added to the system (right panel). The results presented here represent those of one of three experiments performed for this experimental series. (B) Apoptosis was also assessed by CD16 shedding (left panel). Only the apoptotic neutrophils (CD16 negative) were permeabilized by the addition of LL-37 and stained positive for 7-AAD. The {alpha}-CD16 antibody also gained access to intracellular CD16 upon permeabilization, as shown by the increase in the fluorescence intensity of CD16 (right panel). The plots represent those from one of two independent experiments that were performed. Each plot shows the means ± SDs from one representative experiment.

In order to rule out the possibility that an undefined interaction between LL-37 and annexin V caused the permeabilization, experiments were conducted with CD16 instead of annexin V as a marker for neutrophil apoptosis (Fig. 2B, left panel). CD16 is a surface protein present on viable neutrophils (Fig. 2B, left panel, lower right quadrant) that is lost upon apoptosis (Fig. 2B, left panel, lower left quadrant), and only cells negative for CD16 (i.e., apoptotic cells) became 7-AAD positive after addition of peptide (Fig. 2B, right panel). After addition of LL-37, the apoptotic cell population was permeant not only to the nuclear dye 7-AAD but also, apparently, to the {alpha}-CD16 antibody that gained access to intracellular CD16 and, as a result, conferred a CD16 signal to the permeabilized cells (Fig. 2B, right panel).

Selective permeabilization of apoptotic NK cells by LL-37. Inflammatory cells other than neutrophils have the ability to enter apoptosis as well. NK cells are cytotoxic, large granular lymphocytes important for eradicating viruses and combating tumor cells. One efficient way to drive NK cell apoptosis is to subject these cells to extracellular reactive oxygen species (23). To test whether the selective permeabilization of apoptotic cells applied only to neutrophils or if it represents a more general mechanism that acts on other leukocytes as well, NK cells were isolated and subjected to H2O2 treatment for the induction of apoptosis. Untreated NK cells incubated for 6 h displayed only 5% apoptotic cells, as assessed by annexin V and 7-AAD labeling (Fig. 3A). When the cells were coincubated with H2O2 (200 µM), a larger population (17%) became apoptotic (Fig. 3B), resulting in a mixed population of viable and apoptotic NK cells. A population of NK cells (16%) also appeared to be permeabilized after the addition of H2O2 (Fig. 3B, upper right quadrant). After this mixed population was washed, it was treated with LL-37 (5 µg/ml, 5 min of incubation), and with these leukocytes, the apoptotic cells were also primarily permeabilized (Fig. 3C). When the results for the LL-37-treated viable population were compared to those for the H2O2-treated control cells, no significant difference was found (P = 0.07; n = 3). A lower standard concentration of LL-37 was used against the NK cells than against the neutrophils (5 µg/ml and 50 µg/ml, respectively), owing to the fact that NK cells were more susceptible to the cytotoxic action of LL-37. At 10 µg/ml, a substantial amount of cytotoxicity against NK cells was observed (the proportion of viable cells dropped from 82.6% to 38.5%; data not shown). At 5 µg/ml of LL-37, mainly apoptotic (annexin V-positive) NK cells were permeabilized, whereas the permeabilization of viable cells was not statistically significantly reduced. These data indicate that the selective permeabilization of apoptotic cells is independent of the type of leukocyte.


Figure 3
View larger version (22K):
[in this window]
[in a new window]

 
FIG. 3. Selective permeabilization of apoptotic NK cells by LL-37. (A) Isolated NK cells were incubated for 6 h and stained with annexin V and 7-AAD. Only a small amount of cells displayed apoptotic characteristics (4.7 ± 1.2%; n = 3). (B) When the cells were incubated in the presence of H2O2 (200 µM) for 6 h, the population of apoptotic NK cells increased (16.8 ± 3.3%; n = 3). The population of permeabilized NK cells also increased upon addition of H2O2 (from 5.3 ± 2.2% to 16.0 ± 4.2%; n = 3). (C) When LL-37 (5 µg/ml) was added to the H2O2-treated NK cells, the apoptotic population was permeabilized and stained positive for 7-AAD, in accordance with the results seen for neutrophils. At this concentration, no significant permeabilization of the viable population compared to that for the population treated with H2O2 alone was seen (P = 0.07; n = 3).

Characterization of selective permeabilization. Dose titration experiments revealed that the permeabilizing effect on apoptotic neutrophils was concentration dependent starting at approximately 10 µg/ml, and a full effect was reached at 50 µg/ml of LL-37. The half-maximal effective concentration (EC50) was determined for the selective permeabilization of apoptotic cells by plotting the mean value of the percentage of apoptotic cells at concentrations 0, 5, 10, and 50 µg/ml for three separate experiments and fitting a straight line to the data set (R2 = 0.99); the EC50 for the permeabilization of apoptotic neutrophils was 27 µg/ml. At 500 µg/ml, a more general cytotoxic effect was observed; in addition to the permeabilization of all apoptotic cells, viable neutrophils were also affected (Fig. 4A) (P < 0.001 compared to the results for viable neutrophils treated with buffer). The EC50 was also determined for the cytotoxic action of LL-37 against viable cells by plotting the mean value of the percentage of viable cells obtained after treatment with LL-37 at concentrations of 0, 5, 10, 50, 100, and 500 µg/ml from three separate experiments. A straight line was fitted to the data set (R2 = 0.97), the trend line was extrapolated, and the EC50 was determined to be 700 µg/ml. Due to technical limitations, we could not use concentrations of LL-37 higher than 500 µg/ml. On the basis of EC50s, the concentration needed for the permeabilization of viable neutrophils (general cytotoxicity) was found to be approximately 25 times higher than that needed for the permeabilization of apoptotic neutrophils. Time and titration experiments showed that the specificity was intact (i.e., viable cells were unaffected) for at least the first 5 min (P > 0.05 compared to the results obtained by treatment with buffer alone). Almost all annexin V-positive cells became leaky within 5 min of LL-37 addition (Fig. 4B). In an attempt to study the leakage within the first 5 min, we analyzed the process (7-AAD fluorescence) kinetically in a flow cytometer, having first gated the cells on the basis of annexin V staining (Fig. 4C, left panel). Increased 7-AAD staining was apparent immediately after addition of LL-37 (Fig. 4C, right panel) in the annexin V-positive cells (red), whereas the annexin V-negative population (green) never became 7-AAD positive. These results again showed that only apoptotic cells were permeabilized by LL-37 and that the leakage started immediately after addition of peptide.


Figure 4
View larger version (33K):
[in this window]
[in a new window]

 
FIG. 4. The permeabilizing effect of LL-37 on neutrophils is concentration dependent and rapid. (A) Different concentrations of LL-37 ranging from 0 to 500 µg/ml were tested; increased concentrations led to an increased permeabilizing effect on the apoptotic cells, and at 500 µg/ml, a more general cytotoxic action that also affected viable neutrophils was observed. The percentage of cells is plotted against the LL-37 concentration; and the populations were viable (blue), apoptotic (red), and permeabilized (black). Mean ± SDs (n = 3) are shown. The results for each population were compared to those for an untreated sample, and significance was established, as indicated, by analysis of variance and Bonferroni's test for multiple comparisons. (B) Within 5 min after the addition of LL-37 (50 µg/ml), the permeabilizing action was complete. The membranes of viable cells retained their integrity for at least 5 min. The percentage of cells is plotted against time; and the populations were viable (blue), apoptotic (red), and permeabilized (black). Mean ± SDs (n = 3) are shown. Statistical significance was determined as indicated above for panel A. (C) After the gating of viable (green) and apoptotic (red) cells with the aid of annexin V staining (left panel), the increase in the intensity of 7-AAD staining after the addition of LL-37 (50 µg/ml) was monitored in real time. Only the apoptotic cells displayed an increase in 7-AAD intensity (right panel), and the permeabilization started immediately following addition of the peptide (arrow). The results represent those of one of two experiments that were performed. **, P < 0.01; ***, P < 0.001.

Cationicity alone was not sufficient to confer direct microbicidal action (Fig. 1A) or specific permeabilization (Fig. 2A, right panel), since sLL-37 displayed no activity in these assays (at the highest concentrations used of 7.5 µg/well and 500 µg/ml, respectively). We next tested the direct microbicidal and immunomodulatory peptide Hp(2-20), which combines cationicity with an alpha-helical nature, i.e., classical features of cationic host defense peptides (13). This peptide was unable to permeabilize leukocytes (viable or apoptotic) up to concentrations of 2 mM (data not shown), showing that the selective action described for LL-37 is not a general feature of cationic, alpha-helical host defense peptides.

The effect of LL-37 on apoptotic neutrophils is independent of known surface receptors and Ca2+ signaling. LL-37 has been reported to employ a variety of surface receptors for the mediation of its immunomodulatory effects; for neutrophils, two of the most likely receptor candidates are FPRL1 and P2X7 (17, 39). We used the antagonists WRW4 (4) and oxATP (38) to block FPRL1 and P2X7, respectively. In the presence of these two antagonists, the apoptotic cells were still permeabilized (Fig. 5A), indicating that the permeabilization was independent of known surface receptors. According to the general dogma, apoptotic cells are nonfunctional and should thus be unable to transmit intracellular signals (2). When FPRL1 and P2X7 are activated, they transmit signals that result in the mobilization of intracellular calcium (15). Using flow cytometry with mixed neutrophil samples containing both viable and apoptotic cells, we gated the cells on the basis of annexin V staining and measured the intracellular calcium mobilization in both types of cells simultaneously (Fig. 5B). Stimulation of the mixed population with the potent FPRL1 ligand WKYMVM resulted in a classic intracellular calcium flux (Fig. 5B, right panel) for the viable cells (green), whereas the apoptotic cells (red) were completely unresponsive. These data indicate that the permeabilizing effect of LL-37 on apoptotic cells is most likely independent of surface receptors and/or active cell signaling. In this respect, the permeabilizing effect was different from other (mostly receptor-dependent) immunomodulatory effects on leukocytes reported previously (10). In conclusion, the effect of LL-37 on apoptotic leukocytes is closely related to the direct microbicidal, permeabilizing effect of LL-37 rather than immunomodulating, receptor-dependent effects.


Figure 5
View larger version (11K):
[in this window]
[in a new window]

 
FIG. 5. The effect of LL-37 on neutrophils is independent of known receptors and Ca2+ signaling. (A) A mixed population of viable and apoptotic neutrophils was treated with the two antagonists WRW4 (5 µM) and oxATP (900 µM), which antagonize two known LL-37 neutrophil receptors, FPRL1 and P2X7, respectively. In the presence of the antagonists, LL-37 (50 µg/ml) still permeabilized apoptotic, annexin V-positive cells. Paired t tests were performed to establish statistical significance (n = 3). (B) An overnight preparation of incubated neutrophils was assessed for annexin V staining, and a mixed population of both viable (green) and apoptotic (red) neutrophils (left panel) was shown. The mixed population was stimulated with the potent neutrophil FPRL1 ligand WKYMVM (10–7 M), and the transient Ca2+ release was monitored by flow cytometry. The viable cells (green line) responded with a rise in the intracellular Ca2+ concentration, while the apoptotic cells (red line) were totally irresponsive. The results of one representative experiment are shown. The FL-1/FL-3 ratio was plotted against time (right panel). *, P < 0.05; ***, P < 0.001.

Inhibition by serum components. We hypothesized that the mechanism behind the observed specific permeabilization of apoptotic cells by LL-37 had more in common with its direct microbicidal effects than its immunomodulatory actions. The direct microbicidal effect of LL-37 is known to be inhibited by various serum components like HDL and apolipoprotein A1 (32, 55), and in our microbicidal assay, the presence of HDL also markedly inhibited bacterial killing by the peptide. When HDL was added to the inhibition zone plates at levels expected to be found in serum (650 µg/ml), the inhibition zone size generated by LL-37 was markedly decreased (Fig. 6A).


Figure 6
View larger version (25K):
[in this window]
[in a new window]

 
FIG. 6. The permeabilizing effect of LL-37 on apoptotic neutrophils is inhibited by human serum and HDL. (A) When HDL (650 µg/ml) was added to the inhibition zone plates, the clear zone surrounding the well after the addition of LL-37 (1.88 µg/well) decreased markedly. (B) In a control experiment, apoptotic neutrophils were readily permeabilized by the addition of LL-37 (50 µg/ml; left panel). When LL-37 was added to cells in a solution containing 10% normal human serum, the permeabilizing effect was totally blocked (middle panel). The addition of HDL (650 µg/ml) to the neutrophil population prior to the addition of LL-37 (50 µg/ml) also inhibited the permeabilizing effect of LL-37 on apoptotic neutrophils (right panel). Representative plots from three independent experiments and means ± SDs summarized from three independent experiments are shown.

We next subjected a mixed population of neutrophils (viable and apoptotic) to LL-37 in the presence or the absence of either 10% human serum or HDL (650 µg/ml). Both serum and HDL completely blocked the LL-37-induced permeabilization of apoptotic neutrophils (Fig. 6B). The immunomodulatory, receptor-dependent effects of LL-37 have previously been shown to be intact in the presence of serum (17), in which HDL is a prominent protein. These data further strengthen the hypothesis that the observed effect is, in fact, receptor independent. When a salt solution composed to mimic the composition of 10% serum or bovine serum albumin (0.5%; wt/vol) was added, no inhibitory effects were observed (data not shown). These data imply that the presence of proteins in general and serum salts does not impair the function of LL-37.

Negatively charged PS is insufficient to mediate membrane permeabilization by LL-37. One plausible cause of the specific action of LL-37 on apoptotic cells could be the changes in membrane composition that accompany apoptosis, such as the surface exposure of the phospholipid PS. This negatively charged molecule could theoretically confer an affinity for the positively charged peptide, similar to the reported electrostatic interaction between LL-37 and LPS (30, 31). We checked whether LL-37 displays a direct affinity for PS by testing whether it binds to phospholipids and glycosphingolipids immobilized on a solid phase (50). When an attempt was made to bind LL-37 to total lipid extracts from human erythrocytes (40 µg) and control mixtures of acid glycosphingolipids from various sources (40 µg each), which were separated on thin-layer chromatograms, or to pure PE, PC, and PS (4 µg each), no specific binding of LL-37 to any of these compounds was observed (data not shown). In a microtiter well assay, the anionic GM1 ganglioside [Galβ3GalNAcβ4(NeuAc{alpha}3)Galβ4Glcβ1Cer] and the neutral phospholipid PE were included as controls. LL-37 exerted no specificity toward PS compared to its specificity toward the other two lipids found in eukaryotic membranes included in this assay (data not shown).

We next checked whether the presence of PS could contribute to making membrances sensitive to the lytic action of LL-37 by incorporating PS into liposomes containing the phospholipids typically found in eukaryotic membranes and subsequently measuring the level of calcein leakage after addition of the peptide. The incorporation of PS into liposomes containing phospholipids typically found in eukaryotic membranes did not confer any permeabilizing activity on LL-37 (Fig. 7). The total amounts of calcein released (determined by calculation of the area under the curve) for the two liposome preparations were determined and when the means were compared, no significant difference between the two was found (P = 0.08; n = 3).


Figure 7
View larger version (22K):
[in this window]
[in a new window]

 
FIG. 7. The selectivity of LL-37 for lysis of apoptotic cells is independent of PS exposure. Liposomes containing typical eukaryotic lipids were prepared without PS (green line) or with 10% PS (red line). LL-37 (5 ng/ml) was added, as indicated by the arrow, to the different liposomes, and calcein leakage was monitored over time. The introduction of PS in liposomes containing the phospholipids typically found in eukaryotic membranes had no effect. The percentage of total calcein released, as assessed by the addition of Triton X-100, is plotted against time. The ranges for the two data sets are shown. The total amount of calcein released over 225 s (determined from the area under the curve) was established and did not differ significantly (P = 0.08; n = 3) between the two types of liposomes.

The presence of PS did not change the susceptibilities of the liposomes to the lytic activity of LL-37, and the peptide did not seem to have any direct affinity for PS. We next hypothesized that LL-37 does not have any specific affinity for the apoptotic cells but instead interacts with both viable and apoptotic cells to the same extent and in this way induces limited membrane damage. The differences in the outcomes would then be due to the fact that the nonfunctional apoptotic cells are unable to repair the disturbed membrane, whereas the viable cells are quick to reseal the disruption. Viable cells are equipped with a complex machinery that allows them to repair membrane damage, and that machinery often involves a variety of cytoskeletal filaments such as actin and microtubuli (36). We therefore subjected mixed neutrophil populations containing both viable and apoptotic cells to different inhibitors of cytoskeletal filament function in order to see whether such treatment would also enable the permeabilization of viable cells. Treatment of cells with cytochalasin B (which inhibits actin polymerization) (29) or colchicine (which perturbs microtubule assembly) (8) before addition of LL-37 did not make the viable cells sensitive to the lytic action of LL-37 (data not shown). In addition, the local anesthetic lidocaine, which is known to modify cell membrane fluidity (59), did not alter the pattern of susceptibility to LL-37; i.e., the peptide still permeabilized only the annexin V-positive cells (data not shown).

Permeabilization of apoptotic cells by LL-37 is associated with leakage of intracellular as well as intragranular constituents. Among the inflammatory leukocytes, neutrophils harbor an especially potent arsenal of proteolytic enzymes that could be very harmful to surrounding cells and tissues if they were released in an uncontrolled fashion. Apoptotic cells with an intact cell membrane retain their intracellular substances, and to see if permeabilization by LL-37 resulted in true leakage, we measured the extracellular presence of the cytoplasmic enzyme LDH. Peptide treatment of mixed neutrophil samples resulted in the release of LDH, and the levels of release correlated well with the level of apoptosis in the original cell sample; {alpha}-CD95-treated cells (74.8 ± 2.0% apoptotic cells; mean ± SD, n = 3) released significantly more LDH (P = 0.009) after addition of LL-37 than the spontaneously apoptotic cells did (35.5 ± 4.9% apoptotic cells; mean ± SD, n = 3) (Fig. 8A).


Figure 8
View larger version (14K):
[in this window]
[in a new window]

 
FIG. 8. Release of LDH and MPO from LL-37-treated apoptotic neutrophils. (A) Neutrophils were incubated together with or without the apoptosis inducer {alpha}-CD95; the result was 75% apoptotic cells and 45% apoptotic cells, respectively, in this set of experiments. These cells were treated with 50 µg/ml of LL-37 for 10 min, and the amount of the cytosolic enzyme LDH released was measured. It corresponded well with the fraction of apoptotic cells seen for each treatment, indicating the complete release of LDH from apoptotic neutrophils. Means + SDs (n = 3) are shown. Statistical significance was established by an unpaired t test. (B) The release of the intragranular matrix protein MPO was also measured in {alpha}-CD95-treated neutrophils. The amount of MPO released was significantly higher for LL-37-treated cells than for untreated cells. Means + SDs (n = 3) are shown. A paired t test was used for statistical analysis. **, P < 0.01.

Most potent enzymes of neutrophils are, however, not stored in the cytoplasm but, rather in intracellular, membrane-enclosed granules such as the azurophil granules (19). We looked at the release of the azurophil granule protein MPO from {alpha}-CD95-treated neutrophils and found that LL-37 indeed provoked the release of significant amounts of MPO from these cells (Fig. 8B). Taken together, these data show that LL-37 is able to permeabilize the cell membranes of apoptotic neutrophils, leading to the leakage of cytoplasmic contents. In addition, the fact that MPO was released from LL-37-treated apoptotic neutrophils also indicates that the granular membranes are permeabilized, facilitating the extracellular release of various potentially deleterious substances.


arrow
DISCUSSION
 
The human cathelicidin LL-37 was originally identified as a cationic alpha-helical antibacterial peptide capable of microbial killing mediated by its interaction with the microbial membranes (1, 16, 31). Clearly, the peptide is capable of distinguishing between membranes with different compositions, and eukaryotic cells are much less susceptible to membrane attacks from LL-37 than, e.g., bacterial membranes. More recently, it has also been shown that LL-37 is capable of modulating the activity of several important immune cells (9). Similar to certain other peptides (7, 13, 51, 58), LL-37 displays a functional dualism, in that it directly kills microbes and modulates immune cell function; both of these activities are likely important for host defense. It is well known that leukocytes change the composition of their membranes during, e.g., apoptotic cell death. The differences between the membranes of viable and apoptotic cells relate not only to the expression of various surface proteins but also to their phospholipids compositions (35). On the basis of these facts and the ability of LL-37 to distinguish between different types of membranes, we reasoned that the peptide could possibly discriminate between viable and apoptotic leukocytes. Primary human neutrophils gradually enter apoptosis spontaneously during in vitro culture, enabling easy access to mixed cell samples containing both viable and apoptotic cells from the same donor. We thus used neutrophils as a model cell and showed that LL-37 selectively induced the permeabilization of apoptotic neutrophils, leaving the viable cells intact. In addition, a similar pattern of selective permeabilization of apoptotic cells was seen for NK cells rendered apoptotic by hydrogen peroxide treatment, indicating that the effect was not limited to neutrophils. NK cells were more susceptible to the lytic action of LL-37, and at concentrations higher than 5 µg/ml, LL-37 displayed a more general cytotoxicity against purified NK cells. Viable neutrophils were not permeabilized until LL-37 concentrations exceeded 100 µg/ml, and it makes sense that neutrophils, being important reservoirs for LL-37, should be more resistant to peptide-induced membrane disruption.

The immunomodulatory actions of LL-37, as opposed to its direct microbicidal effects, are primarily mediated by receptor binding. The surface receptors most often implicated in LL-37-mediated responses in neutrophils are the chemoattractant receptor FPRL1 (17) and the nucleotide receptor P2X7 (39). Antagonists for these receptors, WRW4 (an antagonist of FPRL1 [4] and oxATP (an antagonist of P2X7 [38]), did not affect the LL-37-induced permeabilization of apoptotic neutrophils, nor did they influence the susceptibilities of viable cells. These findings suggest that neither FPRL1 nor P2X7 is involved in the specific permeabilization of apoptotic cells. We also showed that the apoptotic cells in our mixed neutrophil samples were completely unable to mobilize intracellular calcium in response to FPRL1 activation, indicating that these cells are, in fact, nonfunctional and incapable of transmitting intracellular signals. Taken together, the permeabilization of apoptotic cells is highly unlikely to depend on the interaction of LL-37 with surface receptors or even active signal transduction. This makes the effect of LL-37 on apoptotic leukocytes appear to be much more like its direct microbicidal action than its immunomodulatory functions. The fact that the presence of blood constituents (serum or HDL) that inhibit LL-37's direct microbicidal effect was also effective at blocking the permeabilization of apoptotic cells supports this view.

LL-37 has previously been shown to inhibit apoptosis (39) as well as promote the necrosis (6) of human neutrophils, and it is likely that the induction of secondary necrosis could explain the former finding, as was proposed in a study published during the preparation of the manuscript (61). In line with this, our data presented here imply that in the presence of LL-37, cells that spontaneously enter apoptosis are rapidly permeabilized and are eventually lost from subsequent analyses. The viable cells, however, would be unaffected by the peptide, resulting in an apparent enrichment of viable cells at the expense of apoptotic cells, which could lead to the false impression that LL-37 inhibits apoptosis. We also show that the LL-37-induced permeabilization of apoptotic cells destroys the integrity of the plasma membrane, as seen by the leakage of the cytoplasmic enzyme LDH to the extracellular space. In addition, we could also see the leakage of MPO, which is stored in the azurophil granules (19). Since this granule type is responsible for storing most of the proteolytic enzymes (19) as well as the immunomodulatory molecules, this finding is important and indicates that LL-37-mediated permeabilization could be a potent means of getting such substances out to an extracellular location. The functional consequences of releasing tissue-destroying enzymes in combination with molecules that facilitate wound healing remain to be determined. Interestingly, the levels of MPO released were lower than anticipated, on the basis of the proportion of apoptotic cells; it is possible that LL-37 interacts electrostatically with anionic membrane components and sticks to the plasma membrane during permeabilization. The permeabilization of azurophil granules could also require a time longer than the time required for permeabilization of the plasma membrane. One must also take into account the possible release of hCAP-18 from the specific granules in neutrophils upon permeabilization. If LL-37 is cleaved extracellularly by proteinase 3, the accumulation of additional LL-37 could result in a positive-feedback loop.

The mere cationicity of a peptide is not sufficient to induce specific permeabilization, since sLL-37 was inert in terms of direct microbicidal activity as well as in the permeabilization of apoptotic cells. Cationicity combined with an alpha-helical structure was also not enough to permeabilize apoptotic cells, since Hp(2-20) did not possess this ability, even though it potently kills bacteria (43). This Helicobacter pylori peptide is in many ways similar to LL-37 and also shares specificity for FPRL1 as a neutrophil receptor (13). We first hypothesized that flipping of the negatively charged PS from the inner leaflet of the lipid bilayer to the outer leaflet could confer susceptibility to the cationic peptide LL-37. Several studies have shown that cationic peptides have an increased affinity (and killing capacity) for cancer cells compared to their affinity for healthy cells and that this is due to the fact that cancer cells have more negatively charged plasma membranes (54, 62). This charge difference partly originates from the various amounts of PS present on the outer leaflet of the plasma membranes (41). However, our data generated from liposome studies and chromatogram binding assays failed to support a direct role for PS. It is likely that apoptotic membrane changes other than the flipping of PS could explain the selective action of LL-37 on the apoptotic membranes.

In striking contrast to most immunomodulatory functions of LL-37 that are intact or that even depend on the presence of serum (48), we found that serum completely blocked the permeabilization of apoptotic cells. In this respect, the effect that we describe seems to be much more related to the direct microbicidal action of LL-37. With this in mind, it is reasonable to assume that the ability of LL-37 to permeabilize apoptotic cells in vivo would be of importance mainly at sites devoid of serum components, such as the skin or the lungs. LL-37 is very highly expressed in psoriatic scales of the skin and contributes to keeping the scales free of microbial pathogens (40). In addition, psoriatic scales are characterized by the continued presence of neutrophils, indicative of a chronic state of acute inflammation (52). Our findings that LL-37 induces permeabilization of apoptotic leukocytes, concomitant with the leakage of both cytoplasmic and granular proteins, could thus help explain why a state of acute inflammation fails to resolve at sites rich in LL-37 and deprived of serum components.


arrow
ACKNOWLEDGMENTS
 
The Gothenburg group was supported by grants from the Swedish Research Council, the King Gustav V 80-Year Foundation, and the Swedish state under the LUA/ALF agreement. D.J.D. is a Wellcome Trust Research Career Development Fellow (fellowship no. 078265). S.T. is supported by the Swedish Research Council and the Swedish Cancer Foundation.


arrow
FOOTNOTES
 
* Corresponding author. Mailing address: Department of Rheumatology and Inflammation Research, University of Gothenburg, Guldhedsgatan 10, Gothenburg S-413 46, Sweden. Phone: 46 31 342 46 35. Fax: 46 31 82 88 98. E-mail: ase.bjorstad{at}rheuma.gu.se Back

{triangledown} Published ahead of print on 15 December 2008. Back


arrow
REFERENCES
 
    1
  1. Agerberth, B., H. Gunne, J. Odeberg, P. Kogner, H. G. Boman, and G. H. Gudmundsson. 1995. FALL-39, a putative human peptide antibiotic, is cysteine-free and expressed in bone marrow and testis. Proc. Natl. Acad. Sci. USA 92:195-199.[Abstract/Free Full Text]
  2. 2
  3. Akgul, C., D. A. Moulding, and S. W. Edwards. 2001. Molecular control of neutrophil apoptosis. FEBS Lett. 487:318-322.[CrossRef][Medline]
  4. 3
  5. Atlas, R. M. 1997. Handbook of microbiological media, 2nd ed. CRC Press, Boca Raton, FL.
  6. 4
  7. Bae, Y. S., H. Y. Lee, E. J. Jo, J. I. Kim, H. K. Kang, R. D. Ye, J. Y. Kwak, and S. H. Ryu. 2004. Identification of peptides that antagonize formyl peptide receptor-like 1-mediated signaling. J. Immunol. 173:607-614.[Abstract/Free Full Text]
  8. 5
  9. Bals, R., and J. M. Wilson. 2003. Cathelicidins—a family of multifunctional antimicrobial peptides. Cell. Mol. Life Sci. 60:711-720.[CrossRef][Medline]
  10. 6
  11. Barlow, P. G., Y. Li, T. S. Wilkinson, D. M. Bowdish, Y. E. Lau, C. Cosseau, C. Haslett, A. J. Simpson, R. E. Hancock, and D. J. Davidson. 2006. The human cationic host defense peptide LL-37 mediates contrasting effects on apoptotic pathways in different primary cells of the innate immune system. J. Leukoc. Biol. 80:509-520.[Abstract/Free Full Text]
  12. 7
  13. Betten, A., J. Bylund, T. Cristophe, F. Boulay, A. Romero, K. Hellstrand, and C. Dahlgren. 2001. A proinflammatory peptide from Helicobacter pylori activates monocytes to induce lymphocyte dysfunction and apoptosis. J. Clin. Investig. 108:1221-1228.[CrossRef][Medline]
  14. 8
  15. Bhattacharyya, B., D. Panda, S. Gupta, and M. Banerjee. 2008. Anti-mitotic activity of colchicine and the structural basis for its interaction with tubulin. Med. Res. Rev. 28:155-183.[CrossRef][Medline]
  16. 9
  17. Bowdish, D. M., D. J. Davidson, and R. E. Hancock. 2006. Immunomodulatory properties of defensins and cathelicidins. Curr. Top. Microbiol. Immunol. 306:27-66.[Medline]
  18. 10
  19. Bowdish, D. M., D. J. Davidson, Y. E. Lau, K. Lee, M. G. Scott, and R. E. Hancock. 2005. Impact of LL-37 on anti-infective immunity. J. Leukoc. Biol. 77:451-459.[Abstract/Free Full Text]
  20. 11
  21. Boyum, A. 1968. Isolation of mononuclear cells and granulocytes from human blood. Isolation of monuclear cells by one centrifugation, and of granulocytes by combining centrifugation and sedimentation at 1 g. Scand. J. Clin. Lab. Investig. Suppl. 97:77-89.[Medline]
  22. 12
  23. Boyum, A., D. Lovhaug, L. Tresland, and E. M. Nordlie. 1991. Separation of leucocytes: improved cell purity by fine adjustments of gradient medium density and osmolality. Scand. J. Immunol. 34:697-712.[CrossRef][Medline]
  24. 13
  25. Bylund, J., T. Christophe, F. Boulay, T. Nystrom, A. Karlsson, and C. Dahlgren. 2001. Proinflammatory activity of a cecropin-like antibacterial peptide from Helicobacter pylori. Antimicrob. Agents Chemother. 45:1700-1704.[Abstract/Free Full Text]
  26. 14
  27. Chen, C. I., S. Schaller-Bals, K. P. Paul, U. Wahn, and R. Bals. 2004. Beta-defensins and LL-37 in bronchoalveolar lavage fluid of patients with cystic fibrosis. J. Cyst. Fibros. 3:45-50.[CrossRef][Medline]
  28. 15
  29. Christenson, K., L. Bjorkman, C. Tangemo, and J. Bylund. 2008. Serum amyloid A inhibits apoptosis of human neutrophils via a P2X7-sensitive pathway independent of formyl peptide receptor-like 1. J. Leukoc. Biol. 83:139-148.[Abstract/Free Full Text]
  30. 16
  31. Cowland, J. B., A. H. Johnsen, and N. Borregaard. 1995. hCAP-18, a cathelin/pro-bactenecin-like protein of human neutrophil specific granules. FEBS Lett. 368:173-176.[CrossRef][Medline]
  32. 17
  33. De, Y., Q. Chen, A. P. Schmidt, G. M. Anderson, J. M. Wang, J. Wooters, J. J. Oppenheim, and O. Chertov. 2000. LL-37, the neutrophil granule- and epithelial cell-derived cathelicidin, utilizes formyl peptide receptor-like 1 (FPRL1) as a receptor to chemoattract human peripheral blood neutrophils, monocytes, and T cells. J. Exp. Med. 192:1069-1074.[Abstract/Free Full Text]
  34. 18
  35. Fadok, V. A., A. de Cathelineau, D. L. Daleke, P. M. Henson, and D. L. Bratton. 2001. Loss of phospholipid asymmetry and surface exposure of phosphatidylserine is required for phagocytosis of apoptotic cells by macrophages and fibroblasts. J. Biol. Chem. 276:1071-1077.[Abstract/Free Full Text]
  36. 19
  37. Faurschou, M., and N. Borregaard. 2003. Neutrophil granules and secretory vesicles in inflammation. Microbes Infect. 5:1317-1327.[CrossRef][Medline]
  38. 20
  39. Frohm, M., B. Agerberth, G. Ahangari, M. Stahle-Backdahl, S. Liden, H. Wigzell, and G. H. Gudmundsson. 1997. The expression of the gene coding for the antibacterial peptide LL-37 is induced in human keratinocytes during inflammatory disorders. J. Biol. Chem. 272:15258-15263.[Abstract/Free Full Text]
  40. 21
  41. Gudmundsson, G. H., B. Agerberth, J. Odeberg, T. Bergman, B. Olsson, and R. Salcedo. 1996. The human gene FALL39 and processing of the cathelin precursor to the antibacterial peptide LL-37 in granulocytes. Eur. J. Biochem. 238:325-332.[Medline]
  42. 22
  43. Gutsmann, T., J. W. Larrick, U. Seydel, and A. Wiese. 1999. Molecular mechanisms of interaction of rabbit CAP18 with outer membranes of gram-negative bacteria. Biochemistry 38:13643-13653.[CrossRef][Medline]
  44. 23
  45. Hansson, M., A. Asea, U. Ersson, S. Hermodsson, and K. Hellstrand. 1996. Induction of apoptosis in NK cells by monocyte-derived reactive oxygen metabolites. J. Immunol. 156:42-47.[Abstract]
  46. 24
  47. Hansson, M., S. Hermodsson, M. Brune, U. H. Mellqvist, P. Naredi, A. Betten, K. R. Gehlsen, and K. Hellstrand. 1999. Histamine protects T cells and natural killer cells against oxidative stress. J. Interferon Cytokine Res. 19:1135-1144.[CrossRef][Medline]
  48. 25
  49. Haslett, C. 1999. Granulocyte apoptosis and its role in the resolution and control of lung inflammation. Am. J. Respir. Crit. Care Med. 160:S5-S11.[Abstract/Free Full Text]
  50. 26
  51. Hultmark, D., A. Engstrom, K. Andersson, H. Steiner, H. Bennich, and H. G. Boman. 1983. Insect immunity. Attacins, a family of antibacterial proteins from Hyalophora cecropia. EMBO J. 2:571-576.[Medline]
  52. 27
  53. Hultmark, D., A. Engstrom, H. Bennich, R. Kapur, and H. G. Boman. 1982. Insect immunity: isolation and structure of cecropin D and four minor antibacterial components from Cecropia pupae. Eur. J. Biochem. 127:207-217.[Medline]
  54. 28
  55. Johansson, J., G. H. Gudmundsson, M. E. Rottenberg, K. D. Berndt, and B. Agerberth. 1998. Conformation-dependent antibacterial activity of the naturally occurring human peptide LL-37. J. Biol. Chem. 273:3718-3724.[Abstract/Free Full Text]
  56. 29
  57. Keller, H., and V. Niggli. 1995. Effects of cytochalasin D on shape and fluid pinocytosis in human neutrophils as related to cytoskeletal changes (actin, alpha-actinin and microtubules). Eur. J. Cell Biol. 66:157-164.[Medline]
  58. 30
  59. Kirikae, T., M. Hirata, H. Yamasu, F. Kirikae, H. Tamura, F. Kayama, K. Nakatsuka, T. Yokochi, and M. Nakano. 1998. Protective effects of a human 18-kilodalton cationic antimicrobial protein (CAP18)-derived peptide against murine endotoxemia. Infect. Immun. 66:1861-1868.[Abstract/Free Full Text]
  60. 31
  61. Larrick, J. W., M. Hirata, R. F. Balint, J. Lee, J. Zhong, and S. C. Wright. 1995. Human CAP18: a novel antimicrobial lipopolysaccharide-binding protein. Infect. Immun. 63:1291-1297.[Abstract]
  62. 32
  63. Lau, Y. E., D. M. Bowdish, C. Cosseau, R. E. Hancock, and D. J. Davidson. 2006. Apoptosis of airway epithelial cells: human serum sensitive induction by the cathelicidin LL-37. Am. J. Respir. Cell Mol. Biol. 34:399-409.[Abstract/Free Full Text]
  64. 33
  65. Lopez-Garcia, B., P. H. Lee, K. Yamasaki, and R. L. Gallo. 2005. Anti-fungal activity of cathelicidins and their potential role in Candida albicans skin infection. J. Investig. Dermatol. 125:108-115.[CrossRef][Medline]
  66. 34
  67. Luo, H. R., and F. Loison. 2008. Constitutive neutrophil apoptosis: mechanisms and regulation. Am. J. Hematol. 83:288-295.[CrossRef][Medline]
  68. 35
  69. Martin, S. J., C. P. Reutelingsperger, A. J. McGahon, J. A. Rader, R. C. van Schie, D. M. LaFace, and D. R. Green. 1995. Early redistribution of plasma membrane phosphatidylserine is a general feature of apoptosis regardless of the initiating stimulus: inhibition by overexpression of Bcl-2 and Abl. J. Exp. Med. 182:1545-1556.[Abstract/Free Full Text]
  70. 36
  71. McNeil, P. L., and R. A. Steinhardt. 2003. Plasma membrane disruption: repair, prevention, adaptation. Annu. Rev. Cell Dev. Biol. 19:697-731.[CrossRef][Medline]
  72. 37
  73. McPhee, J. B., and R. E. Hancock. 2005. Function and therapeutic potential of host defence peptides. J. Pept. Sci. 11:677-687.[CrossRef][Medline]
  74. 38
  75. Murgia, M., S. Hanau, P. Pizzo, M. Rippa, and F. Di Virgilio. 1993. Oxidized ATP. An irreversible inhibitor of the macrophage purinergic P2Z receptor. J. Biol. Chem. 268:8199-8203.[Abstract/Free Full Text]
  76. 39
  77. Nagaoka, I., H. Tamura, and M. Hirata. 2006. An antimicrobial cathelicidin peptide, human CAP18/LL-37, suppresses neutrophil apoptosis via the activation of formyl-peptide receptor-like 1 and P2X7. J. Immunol. 176:3044-3052.[Abstract/Free Full Text]
  78. 40
  79. Ong, P. Y., T. Ohtake, C. Brandt, I. Strickland, M. Boguniewicz, T. Ganz, R. L. Gallo, and D. Y. Leung. 2002. Endogenous antimicrobial peptides and skin infections in atopic dermatitis. N. Engl. J. Med. 347:1151-1160.[Abstract/Free Full Text]
  80. 41
  81. Papo, N., and Y. Shai. 2005. Host defense peptides as new weapons in cancer treatment. Cell. Mol. Life Sci. 62:784-790.[CrossRef][Medline]
  82. 42
  83. Partida-Sanchez, S., D. A. Cockayne, S. Monard, E. L. Jacobson, N. Oppenheimer, B. Garvy, K. Kusser, S. Goodrich, M. Howard, A. Harmsen, T. D. Randall, and F. E. Lund. 2001. Cyclic ADP-ribose production by CD38 regulates intracellular calcium release, extracellular calcium influx and chemotaxis in neutrophils and is required for bacterial clearance in vivo. Nat. Med. 7:1209-1216.[CrossRef][Medline]
  84. 43
  85. Putsep, K., C. I. Branden, H. G. Boman, and S. Normark. 1999. Antibacterial peptide from H. pylori. Nature 398:671-672.[CrossRef][Medline]
  86. 44
  87. Savill, J. S., A. H. Wyllie, J. E. Henson, M. J. Walport, P. M. Henson, and C. Haslett. 1989. Macrophage phagocytosis of aging neutrophils in inflammation. Programmed cell death in the neutrophil leads to its recognition by macrophages. J. Clin. Investig. 83:865-875.[Medline]
  88. 45
  89. Schaller-Bals, S., A. Schulze, and R. Bals. 2002. Increased levels of antimicrobial peptides in tracheal aspirates of newborn infants during infection. Am. J. Respir. Crit. Care Med. 165:992-995.[Abstract/Free Full Text]
  90. 46
  91. Schmid, I., W. J. Krall, C. H. Uittenbogaart, J. Braun, and J. V. Giorgi. 1992. Dead cell discrimination with 7-amino-actinomycin D in combination with dual color immunofluorescence in single laser flow cytometry. Cytometry 13:204-208.[CrossRef][Medline]
  92. 47
  93. Shai, Y. 2002. Mode of action of membrane active antimicrobial peptides. Biopolymers 66:236-248.[CrossRef][Medline]
  94. 48
  95. Shaykhiev, R., C. Beisswenger, K. Kandler, J. Senske, A. Puchner, T. Damm, J. Behr, and R. Bals. 2005. Human endogenous antibiotic LL-37 stimulates airway epithelial cell proliferation and wound closure. Am. J. Physiol. Lung Cell. Mol. Physiol. 289:L842-L848.[Abstract/Free Full Text]
  96. 49
  97. Sorensen, O. E., P. Follin, A. H. Johnsen, J. Calafat, G. S. Tjabringa, P. S. Hiemstra, and N. Borregaard. 2001. Human cathelicidin, hCAP-18, is processed to the antimicrobial peptide LL-37 by extracellular cleavage with proteinase 3. Blood 97:3951-3959.[Abstract/Free Full Text]
  98. 50
  99. Teneberg, S., I. Leonardsson, J. Angstrom, S. Ehrlich-Rogozinski, and N. Sharon. 1994. Characterization of the specificity of binding of Moluccella laevis lectin to glycosphingolipids. Glycoconj. J. 11:418-423.[CrossRef][Medline]
  100. 51
  101. Territo, M. C., T. Ganz, M. E. Selsted, and R. Lehrer. 1989. Monocyte-chemotactic activity of defensins from human neutrophils. J. Clin. Investig. 84:2017-2020.[Medline]
  102. 52
  103. Terui, T., M. Ozawa, and H. Tagami. 2000. Role of neutrophils in induction of acute inflammation in T-cell-mediated immune dermatosis, psoriasis: a neutrophil-associated inflammation-boosting loop. Exp. Dermatol. 9:1-10.[CrossRef][Medline]
  104. 53
  105. Thoren, F. B., A. I. Romero, and K. Hellstrand. 2006. Oxygen radicals induce poly(ADP-ribose) polymerase-dependent cell death in cytotoxic lymphocytes. J. Immunol. 176:7301-7307.[Abstract/Free Full Text]
  106. 54
  107. Utsugi, T., A. J. Schroit, J. Connor, C. D. Bucana, and I. J. Fidler. 1991. Elevated expression of phosphatidylserine in the outer membrane leaflet of human tumor cells and recognition by activated human blood monocytes. Cancer Res. 51:3062-3066.[Abstract/Free Full Text]
  108. 55
  109. Wang, Y., B. Agerberth, A. Lothgren, A. Almstedt, and J. Johansson. 1998. Apolipoprotein A-I binds and inhibits the human antibacterial/cytotoxic peptide LL-37. J. Biol. Chem. 273:33115-33118.[Abstract/Free Full Text]
  110. 56
  111. Weiss, S. J. 1989. Tissue destruction by neutrophils. N. Engl. J. Med. 320:365-376.[Medline]
  112. 57
  113. Yasaka, T., N. M. Mantich, L. A. Boxer, and R. L. Baehner. 1981. Functions of human monocyte and lymphocyte subsets obtained by countercurrent centrifugal elutriation: differing functional capacities of human monocyte subsets. J. Immunol. 127:1515-1518.[Abstract]
  114. 58
  115. Yount, N. Y., A. J. Waring, K. D. Gank, W. H. Welch, D. Kupferwasser, and M. R. Yeaman. 2007. Structural correlates of antimicrobial efficacy in IL-8 and related human kinocidins. Biochim. Biophys. Acta 1768:598-608.[Medline]
  116. 59
  117. Yun, I., E. S. Cho, H. O. Jang, U. K. Kim, C. H. Choi, I. K. Chung, I. S. Kim, and W. G. Wood. 2002. Amphiphilic effects of local anesthetics on rotational mobility in neuronal and model membranes. Biochim. Biophys. Acta 1564:123-132.[Medline]
  118. 60
  119. Zanetti, M. 2004. Cathelicidins, multifunctional peptides of the innate immunity. J. Leukoc. Biol. 75:39-48.[Abstract/Free Full Text]
  120. 61
  121. Zhang, Z., G. Cherryholmes, and J. E. Shively. 2008. Neutrophil secondary necrosis is induced by LL-37 derived from cathelicidin. J. Leukoc. Biol. 84:780-788.[Abstract/Free Full Text]
  122. 62
  123. Zwaal, R. F., and A. J. Schroit. 1997. Pathophysiologic implications of membrane phospholipid asymmetry in blood cells. Blood 89:1121-1132.[Free Full Text]


Antimicrobial Agents and Chemotherapy, March 2009, p. 1027-1038, Vol. 53, No. 3
0066-4804/09/$08.00+0     doi:10.1128/AAC.01310-08
Copyright © 2009, American Society for Microbiology. All Rights Reserved.




This article has been cited by other articles:

  • Li, H.-N., Barlow, P. G., Bylund, J., Mackellar, A., Bjorstad, A., Conlon, J., Hiemstra, P. S., Haslett, C., Gray, M., Simpson, A. J., Rossi, A. G., Davidson, D. J. (2009). Secondary necrosis of apoptotic neutrophils induced by the human cathelicidin LL-37 is not proinflammatory to phagocytosing macrophages. J. Leukoc. Biol. 86: 891-902 [Abstract] [Full Text]  

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrowReprints and Permissions
Right arrow Copyright Information
Right arrow Books from ASM Press
Right arrow MicrobeWorld
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Björstad, A.
Right arrow Articles by Bylund, J.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Björstad, A.
Right arrow Articles by Bylund, J.