Skip to main content
  • ASM
    • Antimicrobial Agents and Chemotherapy
    • Applied and Environmental Microbiology
    • Clinical Microbiology Reviews
    • Clinical and Vaccine Immunology
    • EcoSal Plus
    • Eukaryotic Cell
    • Infection and Immunity
    • Journal of Bacteriology
    • Journal of Clinical Microbiology
    • Journal of Microbiology & Biology Education
    • Journal of Virology
    • mBio
    • Microbiology and Molecular Biology Reviews
    • Microbiology Resource Announcements
    • Microbiology Spectrum
    • Molecular and Cellular Biology
    • mSphere
    • mSystems
  • Log in
  • My alerts
  • My Cart

Main menu

  • Home
  • Articles
    • Current Issue
    • Accepted Manuscripts
    • COVID-19 Special Collection
    • Archive
    • Minireviews
  • For Authors
    • Submit a Manuscript
    • Scope
    • Editorial Policy
    • Submission, Review, & Publication Processes
    • Organization and Format
    • Errata, Author Corrections, Retractions
    • Illustrations and Tables
    • Nomenclature
    • Abbreviations and Conventions
    • Publication Fees
    • Ethics Resources and Policies
  • About the Journal
    • About AAC
    • Editor in Chief
    • Editorial Board
    • For Reviewers
    • For the Media
    • For Librarians
    • For Advertisers
    • Alerts
    • AAC Podcast
    • RSS
    • FAQ
  • Subscribe
    • Members
    • Institutions
  • ASM
    • Antimicrobial Agents and Chemotherapy
    • Applied and Environmental Microbiology
    • Clinical Microbiology Reviews
    • Clinical and Vaccine Immunology
    • EcoSal Plus
    • Eukaryotic Cell
    • Infection and Immunity
    • Journal of Bacteriology
    • Journal of Clinical Microbiology
    • Journal of Microbiology & Biology Education
    • Journal of Virology
    • mBio
    • Microbiology and Molecular Biology Reviews
    • Microbiology Resource Announcements
    • Microbiology Spectrum
    • Molecular and Cellular Biology
    • mSphere
    • mSystems

User menu

  • Log in
  • My alerts
  • My Cart

Search

  • Advanced search
Antimicrobial Agents and Chemotherapy
publisher-logosite-logo

Advanced Search

  • Home
  • Articles
    • Current Issue
    • Accepted Manuscripts
    • COVID-19 Special Collection
    • Archive
    • Minireviews
  • For Authors
    • Submit a Manuscript
    • Scope
    • Editorial Policy
    • Submission, Review, & Publication Processes
    • Organization and Format
    • Errata, Author Corrections, Retractions
    • Illustrations and Tables
    • Nomenclature
    • Abbreviations and Conventions
    • Publication Fees
    • Ethics Resources and Policies
  • About the Journal
    • About AAC
    • Editor in Chief
    • Editorial Board
    • For Reviewers
    • For the Media
    • For Librarians
    • For Advertisers
    • Alerts
    • AAC Podcast
    • RSS
    • FAQ
  • Subscribe
    • Members
    • Institutions
Mechanisms of Resistance

Novel Plasmid-Borne Multidrug Resistance Gene Cluster Including lsa(E) from a Linezolid-Resistant Enterococcus faecium Isolate of Swine Origin

Hongbin Si, Wan-Jiang Zhang, Shengbo Chu, Xiu-Mei Wang, Lei Dai, Xin Hua, Zhimin Dong, Stefan Schwarz, Siguo Liu
Hongbin Si
aCollege of Animal Sciences and Technology, Guangxi University, Nanning, China
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Wan-Jiang Zhang
bState Key Laboratory of Veterinary Biotechnology, Harbin Veterinary Research Institute, Chinese Academy of Agricultural Sciences, Harbin, China
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Shengbo Chu
bState Key Laboratory of Veterinary Biotechnology, Harbin Veterinary Research Institute, Chinese Academy of Agricultural Sciences, Harbin, China
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Xiu-Mei Wang
bState Key Laboratory of Veterinary Biotechnology, Harbin Veterinary Research Institute, Chinese Academy of Agricultural Sciences, Harbin, China
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Lei Dai
cDepartment of Veterinary Microbiology and Preventive Medicine, College of Veterinary Medicine, Iowa State University, Ames, Iowa, USA
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Xin Hua
bState Key Laboratory of Veterinary Biotechnology, Harbin Veterinary Research Institute, Chinese Academy of Agricultural Sciences, Harbin, China
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Zhimin Dong
bState Key Laboratory of Veterinary Biotechnology, Harbin Veterinary Research Institute, Chinese Academy of Agricultural Sciences, Harbin, China
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Stefan Schwarz
dInstitute of Farm Animal Genetics, Friedrich-Loeffler-Institut (FLI), Neustadt-Mariensee, Germany
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
Siguo Liu
bState Key Laboratory of Veterinary Biotechnology, Harbin Veterinary Research Institute, Chinese Academy of Agricultural Sciences, Harbin, China
  • Find this author on Google Scholar
  • Find this author on PubMed
  • Search for this author on this site
DOI: 10.1128/AAC.01394-15
  • Article
  • Figures & Data
  • Info & Metrics
  • PDF
Loading

Article Figures & Data

Figures

  • Tables
  • Additional Files
  • FIG 1
    • Open in new tab
    • Download powerpoint
    FIG 1

    Linear comparison of the lsa(E)-carrying plasmid pY13 (GenBank accession no. KR936172) with enterococcal and staphylococcal plasmids pXD4, pXD5, pM7M2, pV7037, and p3. Arrows, positions and directions of transcription of the genes; shading, regions of >99% nucleotide sequence identity in the different plasmids; black arrowheads, the nine overlapping PCRs (PCR1 to PCR9) designed to confirm the pY13 plasmid and the genetic environment of the lsa(E) gene; Δ, a truncated gene.

Tables

  • Figures
  • Additional Files
  • TABLE 1

    Antimicrobial susceptibility of the seven lsa(E)-carrying enterococcal isolates, a transformant, and a recipient strain used in this study

    StrainMLST typeMIC (mg/liter) fora:
    GENKANVIR M1bSTRLINTIAVALERYFFCTETCIPAMPRIFVANLZD
    E. faecalis 11-27ST169128>256>128128256128128>256864161811
    E. faecalis 12-7ST220>256>256>128256256128128>25612864321418
    E. faecalis 14-1ST146256>256>128256128128128>25612812864116216
    E. faecalis E15ST283128>256>128256128128256>25612812864232216
    E. faecalis D12-2ST553128>256>128128128>128256>256128646412216
    E. gallinarum Y15NAc256>25612812812812864>25612864640.5828
    E. faecium Y13ST29>256>256128256128>128128>256646464120.516
    E. faecalis TY13d2>256128256128>128128>25644111≤0.52
    E. faecalis JH2-224224220.54221212
    • ↵a GEN, gentamicin; STR, streptomycin; KAN, kanamycin; VIR M1, virginiamycin M1; LIN, lincomycin; TIA, tiamulin; VAL, valnemulin; ERY, erythromycin; FFC, florfenicol; TET, tetracycline; CIP, ciprofloxacin; AMP, ampicillin; RIF, rifampin; VAN, vancomycin; LZD, linezolid.

    • ↵b Note that E. faecalis is intrinsically resistant to streptogramins.

    • ↵c NA, not applicable.

    • ↵d TY13 was the transformant derived from transformation of plasmid pY13 from E. faecium Y13 into E. faecalis JH2-2.

Additional Files

  • Figures
  • Tables
  • Supplemental material

    • Supplemental file 1 -

      Tables S1 and S2 and Fig. S1

      PDF, 358K

PreviousNext
Back to top
Download PDF
Citation Tools
Novel Plasmid-Borne Multidrug Resistance Gene Cluster Including lsa(E) from a Linezolid-Resistant Enterococcus faecium Isolate of Swine Origin
Hongbin Si, Wan-Jiang Zhang, Shengbo Chu, Xiu-Mei Wang, Lei Dai, Xin Hua, Zhimin Dong, Stefan Schwarz, Siguo Liu
Antimicrobial Agents and Chemotherapy Oct 2015, 59 (11) 7113-7116; DOI: 10.1128/AAC.01394-15

Citation Manager Formats

  • BibTeX
  • Bookends
  • EasyBib
  • EndNote (tagged)
  • EndNote 8 (xml)
  • Medlars
  • Mendeley
  • Papers
  • RefWorks Tagged
  • Ref Manager
  • RIS
  • Zotero
Print

Alerts
Sign In to Email Alerts with your Email Address
Email

Thank you for sharing this Antimicrobial Agents and Chemotherapy article.

NOTE: We request your email address only to inform the recipient that it was you who recommended this article, and that it is not junk mail. We do not retain these email addresses.

Enter multiple addresses on separate lines or separate them with commas.
Novel Plasmid-Borne Multidrug Resistance Gene Cluster Including lsa(E) from a Linezolid-Resistant Enterococcus faecium Isolate of Swine Origin
(Your Name) has forwarded a page to you from Antimicrobial Agents and Chemotherapy
(Your Name) thought you would be interested in this article in Antimicrobial Agents and Chemotherapy.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.
Share
Novel Plasmid-Borne Multidrug Resistance Gene Cluster Including lsa(E) from a Linezolid-Resistant Enterococcus faecium Isolate of Swine Origin
Hongbin Si, Wan-Jiang Zhang, Shengbo Chu, Xiu-Mei Wang, Lei Dai, Xin Hua, Zhimin Dong, Stefan Schwarz, Siguo Liu
Antimicrobial Agents and Chemotherapy Oct 2015, 59 (11) 7113-7116; DOI: 10.1128/AAC.01394-15
del.icio.us logo Digg logo Reddit logo Twitter logo CiteULike logo Facebook logo Google logo Mendeley logo
  • Top
  • Article
    • ABSTRACT
    • TEXT
    • ACKNOWLEDGMENTS
    • FOOTNOTES
    • REFERENCES
  • Figures & Data
  • Info & Metrics
  • PDF

Related Articles

Cited By...

About

  • About AAC
  • Editor in Chief
  • Editorial Board
  • Policies
  • For Reviewers
  • For the Media
  • For Librarians
  • For Advertisers
  • Alerts
  • AAC Podcast
  • RSS
  • FAQ
  • Permissions
  • Journal Announcements

Authors

  • ASM Author Center
  • Submit a Manuscript
  • Article Types
  • Ethics
  • Contact Us

Follow #AACJournal

@ASMicrobiology

       

ASM Journals

ASM journals are the most prominent publications in the field, delivering up-to-date and authoritative coverage of both basic and clinical microbiology.

About ASM | Contact Us | Press Room

 

ASM is a member of

Scientific Society Publisher Alliance

 

American Society for Microbiology
1752 N St. NW
Washington, DC 20036
Phone: (202) 737-3600

Copyright © 2021 American Society for Microbiology | Privacy Policy | Website feedback

Print ISSN: 0066-4804; Online ISSN: 1098-6596