TABLE 3.

Polymorphic amino acid sites found in the 17 distinct beta-lactamases from this study

Amino acid sequence no.aBeta-lactamaseAmino acid at position numberb
111111111111112222222222222222
112222333344455566678999112344566789990122234555566778
782468345816726838958246499501018786785536733234628070
1SHV-1ATAHSQIKLSSMIATTDMMVDEKHAVMAATAREAASQRRRSPADAPNNAIPSQG
2SHV-11........Q.............................................
3SHV-33.........................................S............
4New SHV variant.............................................L........
5LEN-1..VYG...Q...V..A..VLLDR.VILG....A..A.HQ.A.P...DGP...H.
6LEN-2...DG...Q...V..A..VLVDR.VILG....A..A.HQ.A.P...DGP...H.
7New LEN variant 1...YG...Q...V..A..VLLDR.TILG....A..A.HQ.A.P...DGP...H.
8New LEN variant 2...DG...Q...V..A..VLLDR.VILG....A..A.HQ.A.P...DGPL..H.
9New LEN variant 3...YG...Q...V..A..VLLDR.VILG....A..A.HQ.A.....DGP...H.
10New LEN variant 4...DG...Q...V..A..VLLDR.VILG....A..A.HQ.A.....DGP...H.
11New LEN variant 5...DG...Q...V..A..VLLDR.TILG....A..A.HQ.A.P...DGPL..H.
12New LEN variant 6..VYG...Q.P.V..A..VLLDR.VILG...HA..A.HQ.A.P...DGP...H.
13New LEN variant 7...DG...Q...V..A..VLVDR.TILG....A..A.HQ.A.P...DGP...H.
14New OKP variant 1.A.F.P.TR.AYVV.ANL.L.DRR...GKS...V..HTQQA..ES..G.....R
15New OKP variant 2.A.F..VTR.AYV..ASL.L.DRR...GKS...V..HTQQA...S..G...T.R
16New OKP variant 3.A.F....IGAYV.MASL.L.DR....GKS...VTTPSQ.A...S.DG..AT..
17New OKP variant 4TA.F....IGAYV.MASL.L.DR....GKST..VTTPSQQA...S.DG..AT..
  • a Table 1 shows the strains harboring these beta-lactamase sequences.

  • b Dots indicate identity with SHV-1.