TABLE 3.

Amino acid sequence variation among OXY-1 to OXY-6 β-lactamase (bla) groups

Strainbla alleleaEnzymeapIAmino acid at position (Ambler no.):Amino acid at position (Ambler no.):Amino acid at position (Ambler no.):Amino acid at position (Ambler no.):
249 (5)11 (7)12 (8)15 (11)16 (12)17 (13)22 (18)24 (20)25 (21)29 (25)30 (26)31 (27)32 (28)33 (29)34 (30)38 (34)39 (35)43 (39)44 (40)54 (50)56 (52)58 (54)61 (56)75 (72)90 (87)91 (88)92 (89)101 (98)102 (99)103 (100)111 (108)129 (126)140 (137)141 (138)143 (140)156 (153)161 (158)168 (165)171 (168)174 (171)180 (177)184 (181)194 (190)200 (197)230 (227)233 (230)240 (237)256 (255)261 (260)262 (261)270 (269)275 (274)278 (277)
SL781blaOXY-1-1aOXY-1-17.5bLSTLMAAVAGSSADAIQADRSNADTGNPEKKSIAKMSQVTASKTRNAAANVLQSE
SB71blaOXY-1-2aOXY-1-27.7VG
SB9blaOXY-1-2aOXY-1-27.7VG
SG12blaOXY-1-3aOXY-1-3NAcG
SG337blaOXY-1-4aOXY-1-4NADeldV
SG49blaOXY-1-5aOXY-1-5NAVG
KH66blaOXY-1-6aOXY-1-65.25bPK
E23004blaOXY-1-7aOXY-1-77.4b
SG271blaOXY-3-1aOXY-3-16.7bITSIDelLCSDelDelNSTDTNIKDAVGRTEHVLD
SG266blaOXY-4-1aOXY-4-17.7bSDelTLHDIGMG
SB2908blaOXY-5-1aOXY-5-17.2DelHTAIGM
SB2909blaOXY-5-1aOXY-5-17.2DelHAIGM
SB2910blaOXY-5-1aOXY-5-17.2DelHAIGM
SB2942blaOXY-5-1aOXY-5-17.2DelHAIGM
SB2933blaOXY-5-2aOXY-5-27.7DelAIGLM
SB73blaOXY-6-1aOXY-6-17.75SHD
SB75blaOXY-8-1aOXY-6-17.75SHD
SB324blaOXY-6-2aOXY-6-27.75SDelHD
SB352blaOXY-5-3aOXY-6-37.75STHD
SB397blaOXY-6-4aOXY-6-48.1SNHD
SB3037blaOXY-6-4aOXY-6-48.1SNHD
SB3051blaOXY-6-4aOXY-6-48.1SNHD
SB136blaOXY-2-1aOXY-2-1NAIIMLDelATHTNISKNAATLIGHATTESDEVDN
SB175blaOXY-2-2aOXY-2-2NAIIMLDelATHTNISKNAATLIGRATTESDEVDIN
SG77blaOXY-2-3aOXY-2-3NAIIMLDelDelATHTNISKNAATLIGRATTESDEVGDIN
KH11blaOXY-2-4aOXY-2-4NAIIMLDelDelATHTNISKNAATLIGRATTESDEVDN
SG43blaOXY-2-5aOXY-2-5NAIIMLDelDelATHTNISKNAATLIGRATTESDEVDN
SG176blaOXY-2-6aOXY-2-6NAIIMLDelSATHTNISKNAATLIGRATTESDEVDN
SL911blaOXY-2-7aOXY-2-7NAIIMLDelATHTNISKNAATLIGRATTESDEVDN
SC10,436blaOXY-2-8aOXY-2-8NAIIMLDelSATHTNISKNAATLIGRATTESAEVN
  • a Numbered in this study.

  • b Value from the literature.

  • c NA, not available.

  • d Del, deletion.