TABLE 1.

Klebsiella pneumoniae strains studied and their characteristics

StrainGroupSource (sample, geographic) or descriptionrpoB allelebgyrA allelebmdh allelebbla allelebBla enzymebpIfOKP beta-lactamase amino acid variation at position (Ambler numbering in parentheses):
3 (7)9 (13)10 (14)13 (17)19 (23)24 (28)29 (33)30 (34)31 (35)34 (38)43 (47)48 (52)52 (56)55 (59)59 (63)70 (74)86 (90)92 (96)94 (98)129 (133)137 (141)181 (185)184 (188)188 (192)192 (196)193 (197)194 (198)197 (201)211 (215)229 (233)248 (254)256 (262)263 (269)265 (271)267 (273)275 (281)
SB18KpII-ABlood, France111bla OKP-A-1aOKP-A-17.8YISAVPITRSVVTANVQRRSSSAKSHTAQENVPSAR
SB59KpII-ABlood, Spain (Barcelona)222bla OKP-A-2aOKP-A-28.0FQVASDT
SB11KpII-ABlood, Austria33NAbla OKP-A-3aOKP-A-37.1ASADDTK
SB227KpII-ABlood, France33NAbla OKP-A-3aOKP-A-37.1ASADDTK
SB61KpII-ABlood, Switzerland313bla OKP-A-4aOKP-A-48.0FASDT
SB98, Api0320584KpII-AEnvironmental, unknown314bla OKP-A-5aOKP-A-57.1QLASRADDT
SB233KpII-ARespiratory tract, Germany345bla OKP-A-5aOKP-A-68.3AQVASRRADDTK
SB250KpII-ABlood, Spain (Seville)416bla OKP-A-7aOKP-A-77.1CQLASRPADDAK
SB251KpII-ABlood, Spain (Seville)416bla OKP-A-7aOKP-A-77.1CQLASRPADDAK
SB254KpII-ABlood, Spain (Barcelona)217bla OKP-A-8aOKP-A-88.1VASDT
SB255KpII-ABlood, Spain (Barcelona)244bla OKP-A-9aOKP-A-97.1ASAADDTK
SB664KpII-AFeces, Finland414bla OKP-A-10aOKP-A-107.1CPLASADDMTK
SB30KpII-BBlood, Germany558bla OKP-B-1aOKP-B-17.1QKIGAMSHTTPSRDDATG
SB613KpII-BEnvironmental water, The Netherlands669bla OKP-B-2aOKP-B-27.1QKIGASHTTPSRDDATG
SB620KpII-BEnvironmental water, The Netherlands6610bla OKP-B-3aOKP-B-37.1QKIASHITTPSRDDATVG
SB658KpII-BFeces, Finland6611bla OKP-B-4aOKP-B-47.1QKIASHTTPSRDDTVG
SB659KpII-BFeces, Finland6611bla OKP-B-4aOKP-B-47.1QKIASHTTPSRDDTVG
SB662KpII-BFeces, Finland6611bla OKP-B-4aOKP-B-47.1QKIASHTTPSRDDTVG
SB1996KpII-BBlood, The Netherlands7512bla OKP-B-7aOKP-B-77.1QKIASHITTPSRDDATG
SB2001KpII-BAbdominal liquid, The Netherlands8613bla OKP-B-8aOKP-B-87.1QKIASHTITTPSRDDATG
SB2548KpII-BBlood, Austria869bla OKP-B-8aOKP-B-87.1QKIASHTITTPSRDDATG
SB2691KpII-BBlood, United Kingdom8614bla OKP-B-9aOKP-B-97.1QKIIASHTRTPSRDDATVG
SB2727KpII-BRespiratory tract, The Netherlandsa6610bla OKP-B-10aOKP-B-107.1QKIASHTINTTPSRDDATV
SB2728KpII-BRespiratory tract, The Netherlandsa9615bla OKP-B-11aOKP-B-117.1TQKIATSHITTPSRDDTVG
UnnamedcKpII-BUnknownNDNDNDbla OKP-B-5adOKP-B-5d7.1cQKIASHTITTPSRDDTVG
UnnamedcKpII-BUnknownNDNDNDbla OKP-B-6adOKP-B-6d7.1cQKIASHTTPSRDDATG
SB132, ATCC 13883TKpIType strain10716bla SHVSHV7.6e
SB1KpIIIBlood, Austria11817bla LENLEN7.1e
  • a Veterinary isolates.

  • b The rpoB, gyrA, mdh, and bla alleles were given arbitrary numbers in this study. NA, not amplified; ND, not determined.

  • c Siebor et al. (13).

  • d We propose that OKP-5 and OKP-6 be renamed OKP-B-5 and OKP-B-6 for consistency.

  • e Haeggman et al. (6).

  • f The pI values obtained experimentally were totally consistent with expected values deduced from amino acid sequences.