TABLE 1.

Amino acid sequences and molecular masses of antimicrobial peptides and control peptides used in this study

PeptideSequenceMolecular mass (Da)
10203040
DCD-1LSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL4,818.5
SSL-29SSLLEKGLDGAKKAVGGLGKLGKDAVEDL2,869.9
SSL-25SSLLEKGLDGAKKAVGGLGKLGKDA2,412.8
SSL-23SSLLEKGLDGAKKAVGGLGKLGK2,666.2
LL-37[LL-37, 37 aa]4,493.3