TABLE 1.

Properties of Defr1 and related peptidesa

PeptideSequenceChargeΔG (kcal mol−1)
Defr1DPVTYIRNGGICQYRCIGLRHKIGTCGSPFKCCK+6 (+12)−1.92 (−3.84)
Defr1 Y5CDPVTCIRNGGICQYRCIGLRHKIGTCGSPFKCCK+6 (+12)−3.13 (−6.26)
Defr1-1cysDPVTYIRNGGIAQYRAIGLRHKIGTAGSPFKCAK+6 (+12)−3.56 (−7.12)
  • a Amino acid sequence, charge, and hydrophobicity (ΔG) values as calculated by Wimley and White (16) are given for Defr1, Defr1Y5C, and Defr1-1cys. Values are for the monomeric forms of the peptides, with values for the dimeric forms in brackets. Boldface letters indicate the position of cysteine residues in a canonical six cysteine β-defensin motif.