TABLE 2

Lead MAb variable region sequencesa

MAbHeavy chainLight chain
Heavy chain geneHCDR1 sequenceHCDR2 sequenceHCDR3 sequenceLight chain geneLCDR1 sequenceLCDR2 sequenceLCDR3 sequence
TRL845IGHV3-48*02GFTFCRYIISDTSRTIARDPDTPFVRAFDSIGKV1-9*01QLISSYAASPPLNSYPPIT
TRL847IGHV3-48*02GFTFSRFSISDTGRTIARDPDTPFVRAFDSIGKV1-9*01QVISSYAASQQLTTYPPIT
TRL848IGHV3-30*18GFSLWTSGMSYDETKKAKPRLDYLDYFHAADSIGLV3-21*02YIGSKSDDSCQVWETSEDLWV
TRL849IGHV4-31*03GGSISNGGYHIYYRGSTARMPLANYDLLTGLYIGAFDLIGKV3-15*01QSVNRNDASQQYDKWPPG
TRL854IGHV1-2*02GYTFTAYHINPNSGATATDIVVERDASLGGFNSYGMDVIGKV2D-28*01QSLLHSNGYNHLASMQSLQTSIT
  • a The amino acid sequences (in single-letter code) of the three complementarity-determining regions of the MAb heavy and light chains (HCDR1 to HCDR3 and LCDR1 to LCDR3, respectively) are listed. The IMGT designations of the germ line antibody sequences are listed for the heavy and light chains for each MAb.