TABLE 3.

Mutations in L22 ribosomal proteins

StrainaC-terminal conserved sequence of L22 proteinb
Wild type 69DKANLVVSEAFANEGPTMKRFRPRAKGSASPINKRTAHITVAVAEK114
1 AZM 69DKANLVVSEAFANEGPTMKRFRPRAKDSASPINKRTAHITVAVAEK114
3 ERY 69DKANLVVSEAFANEGPTMKRFRPRAKDSASPINKRTAHITVAVAEK114
5 ROX 69DKANLVVSEAFANEGPTMKRFRPRAKDSASPINKRTAHITVAVAEK114
4 ERY 69DKANLVVSEAFANEGPTMKRFRPRAKGSASQINKRTAHITVAVAEK114
3 ROX 69DKANLVVSEAFANEGPTMKRFRPREKGSASPINKRTAHITVAVAEK114
1 TEL 69DKANLVVSEAFANEEPTMKRFRSREKGSASPINKRTAHITVAVAEK114
  • a The mutant designations are explained in footnote a of Table 2. AZM, azithromycin; ERY, erythromycin; ROX, roxithromycin; TEL, telithromycin.

  • b The mutations in the L22 proteins are indicated in boldface and underlined.